Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0027
         (673 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_1092 - 11362094-11362367,11362739-11362795,11363256-113636...    31   1.1  

>12_01_1092 -
           11362094-11362367,11362739-11362795,11363256-11363683,
           11364350-11365462
          Length = 623

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = -3

Query: 671 FNYYDQNLYIFLSYFKRQKM*LLKN*KINVANMVNIKSHLKPLKHSPVKLVSFEIIQLCD 492
           +N   QNL  F+S  + Q   L+K  K+ +  + ++      + H  V  +  +  + CD
Sbjct: 266 YNNVHQNLSQFISSKRSQ---LMKKLKVYIV-VADVSKAFDCVSHDMVLKMIDDAFK-CD 320

Query: 491 DYTVT*CEKTIC 456
           +YTV  C K IC
Sbjct: 321 EYTVRKCSKVIC 332


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,618,660
Number of Sequences: 37544
Number of extensions: 256750
Number of successful extensions: 423
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 417
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 423
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1703141568
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)