BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0027 (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z37093-2|CAA85464.1| 218|Caenorhabditis elegans Hypothetical pr... 28 5.3 AF025452-1|AAB70944.1| 411|Caenorhabditis elegans C-type lectin... 28 5.3 >Z37093-2|CAA85464.1| 218|Caenorhabditis elegans Hypothetical protein ZK669.3 protein. Length = 218 Score = 28.3 bits (60), Expect = 5.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 221 KSTIIDFDAGNYGICNCHRENRKKLL 298 K+T +D ++ + +C+CH NR+ LL Sbjct: 75 KTTCVDSESADDVVCDCHHGNRECLL 100 >AF025452-1|AAB70944.1| 411|Caenorhabditis elegans C-type lectin protein 2 protein. Length = 411 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -3 Query: 353 WKSRPCTDRLKINTRSLLVAISSCFHDGNCKCHNFQR 243 W S CTDR + SC+++ N C+ F R Sbjct: 131 WISADCTDRRSFVCETPTTHEDSCYYNYNNYCYTFHR 167 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,284,004 Number of Sequences: 27780 Number of extensions: 282180 Number of successful extensions: 555 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -