BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0023 (300 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060818-1|AAL28366.1| 251|Drosophila melanogaster GH28833p pro... 28 1.9 AE014297-564|AAF54059.2| 251|Drosophila melanogaster CG31248-PA... 28 1.9 >AY060818-1|AAL28366.1| 251|Drosophila melanogaster GH28833p protein. Length = 251 Score = 28.3 bits (60), Expect = 1.9 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 176 FLRIFAEERCTHTSSRALIEFMAEVDGRCIFFEKFQAAC 292 FL+ F E +R L++FM EVDGR F C Sbjct: 106 FLK-FRNEEVKSPQARRLMDFMIEVDGRIDVCAMFNMVC 143 >AE014297-564|AAF54059.2| 251|Drosophila melanogaster CG31248-PA protein. Length = 251 Score = 28.3 bits (60), Expect = 1.9 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +2 Query: 176 FLRIFAEERCTHTSSRALIEFMAEVDGRCIFFEKFQAAC 292 FL+ F E +R L++FM EVDGR F C Sbjct: 106 FLK-FRNEEVKSPQARRLMDFMIEVDGRIDVCAMFNMVC 143 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,805,178 Number of Sequences: 53049 Number of extensions: 192462 Number of successful extensions: 578 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 24,988,368 effective HSP length: 73 effective length of database: 21,115,791 effective search space used: 549010566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -