BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0021 (749 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 23 2.6 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 23 2.6 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 23 2.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 4.6 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 6.0 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 548 NKFLNYFKKITIASNTQIVYLNVTMWQLSER 456 NK+L ++I IAS Q+ V +W + R Sbjct: 275 NKYLTRARRIEIASALQLNETQVKIWFQNRR 305 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 548 NKFLNYFKKITIASNTQIVYLNVTMWQLSER 456 NK+L ++I IAS Q+ V +W + R Sbjct: 64 NKYLTRARRIEIASALQLNETQVKIWFQNRR 94 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 548 NKFLNYFKKITIASNTQIVYLNVTMWQLSER 456 NK+L ++I IAS Q+ V +W + R Sbjct: 64 NKYLTRARRIEIASALQLNETQVKIWFQNRR 94 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 261 YFIQINCFLLCIYIF 217 YF+ FLLCIY F Sbjct: 135 YFVVPLFFLLCIYYF 149 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 321 YFKIKYLVVKALKCGF*RSIYFIQINCFLLCIYIF 217 YF ++++ + + I F FLLCIY F Sbjct: 102 YFYYAFIILLCVYYFYYAFIIFTVHLLFLLCIYYF 136 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 97 ASIVNLKCTNLSVHFPTP 44 ASI + T+L +H+P P Sbjct: 148 ASIFHAAATSLPLHYPPP 165 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,978 Number of Sequences: 336 Number of extensions: 3345 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -