BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0021 (749 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77920.1 68414.m09080 bZIP family transcription factor contai... 28 7.6 At1g67025.1 68414.m07621 hypothetical protein 28 7.6 >At1g77920.1 68414.m09080 bZIP family transcription factor contains Pfam profile: PF00170 bZIP transcription factor Length = 368 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 548 NKFLNYFKKITIASNTQIVYLNVTMWQLSERN*FTWI 438 N + N F+ + A+ + YL MW+ S F WI Sbjct: 195 NHYANLFQMKSDAAKADVFYLISGMWRTSTERFFQWI 231 >At1g67025.1 68414.m07621 hypothetical protein Length = 221 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -2 Query: 184 NNFNYYVNIINKSFFLLLFK-KNRTTRIIDASIVNLKCTNLSVHF 53 NN N + + N S ++ F +N+T ++D S+ +C ++S++F Sbjct: 41 NNQNLTLVLTNLSLQVISFDLENQTLTVVDESLFEGRCPSMSLNF 85 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,976,230 Number of Sequences: 28952 Number of extensions: 224874 Number of successful extensions: 357 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -