BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0018 (358 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. 23 3.4 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 23 4.5 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 4.5 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 22 6.0 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 7.9 >Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. Length = 124 Score = 23.0 bits (47), Expect = 3.4 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -1 Query: 223 HTLLLHAPPPGHV--REQSQQSTRDGLQAAGRTRK 125 H LL+H P G V RE+ ++ ++G A+ RT++ Sbjct: 24 HHLLVHLHPEGCVRSREEHARAGQEGNVASLRTQE 58 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 22.6 bits (46), Expect = 4.5 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 88 SLLERDRLKLLFIFVYD-LRLVIHLEYFAETVHVHVQAVGHVITA 219 ++ + + LKLL + + LRL + +F T+ VQ GH + A Sbjct: 51 TMQDLNELKLLERCIKEALRLYPSVSFFGRTLSEDVQLGGHQVPA 95 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 22.6 bits (46), Expect = 4.5 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -3 Query: 221 HAVITCPTAWTCT*TVSAKYSRWIT 147 + + TCP TC+ + RW T Sbjct: 31 YQLTTCPGKTTCSQCIQTTNCRWCT 55 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.2 bits (45), Expect = 6.0 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 174 DCSRTCPGGGAC 209 DC TCP AC Sbjct: 789 DCEMTCPNNCAC 800 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 21.8 bits (44), Expect = 7.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 263 INKPSLVRDRPGHLTPSGPNK 325 I P L +DR H TPS P + Sbjct: 1780 IKLPILRKDRLIHSTPSSPQE 1800 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 355,847 Number of Sequences: 2352 Number of extensions: 7383 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26224815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -