BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0013 (744 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4WJC0 Cluster: Nitrate reductase, gamma subunit; n=2; ... 35 2.4 UniRef50_Q54V93 Cluster: Putative uncharacterized protein; n=1; ... 33 9.8 >UniRef50_A4WJC0 Cluster: Nitrate reductase, gamma subunit; n=2; Pyrobaculum|Rep: Nitrate reductase, gamma subunit - Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) Length = 257 Score = 34.7 bits (76), Expect = 2.4 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 4/83 (4%) Frame = -3 Query: 460 WIACNFYWSLFYLYQRFVFNTGLFAT--QITYL*TSKKLQHVIVALLNGTF--LILLGAV 293 W A F+W +F + +T LF T Q+ L S + + + L F + L+G V Sbjct: 76 WGAFLFHWGIFLTL--LIGHTALFFTPGQLQALGISPETRKIAAIYLGAAFGFITLIGLV 133 Query: 292 FMWYLDIFRNNTYELRTPYYLDD 224 +WY + + E++T YLDD Sbjct: 134 MLWYRRLVKK---EVKTFTYLDD 153 >UniRef50_Q54V93 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 884 Score = 32.7 bits (71), Expect = 9.8 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +1 Query: 571 YIHYNVTFDFIIII-HKFLNI*KCDYYSKMATDGDENTLNIIK*HNQNENLNN 726 Y Y+ DFII +K L I K + +SK + + N LN +N N N NN Sbjct: 37 YSFYDAPLDFIIKTRNKQLLIEKLNLFSKFINNNNSNNLNNNNNNNNNNNNNN 89 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,594,356 Number of Sequences: 1657284 Number of extensions: 12749125 Number of successful extensions: 25325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25299 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60911752460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -