BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0013 (744 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061261-1|AAL28809.1| 476|Drosophila melanogaster LD19162p pro... 29 8.8 AF217396-1|AAF73382.1| 476|Drosophila melanogaster unknown prot... 29 8.8 AE014134-94|AAN10496.1| 476|Drosophila melanogaster CG11907-PB,... 29 8.8 AE014134-93|AAF51506.2| 476|Drosophila melanogaster CG11907-PA,... 29 8.8 >AY061261-1|AAL28809.1| 476|Drosophila melanogaster LD19162p protein. Length = 476 Score = 28.7 bits (61), Expect = 8.8 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = -3 Query: 469 WSVWIACNFYWSLFYLYQRFVFNTGLFATQITYL*TSKKLQHVIVALLNGTFLILLGAVF 290 W+ ++ YW Y ++ N ++T L S + A ++GT +LL A+F Sbjct: 80 WNFFVTAEDYWK--YKFRNASINNTDLEEELTPLQKSFTCDLALTATISGTTFLLLNAIF 137 >AF217396-1|AAF73382.1| 476|Drosophila melanogaster unknown protein. Length = 476 Score = 28.7 bits (61), Expect = 8.8 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = -3 Query: 469 WSVWIACNFYWSLFYLYQRFVFNTGLFATQITYL*TSKKLQHVIVALLNGTFLILLGAVF 290 W+ ++ YW Y ++ N ++T L S + A ++GT +LL A+F Sbjct: 80 WNFFVTAEDYWK--YKFRNASINNTDLEEELTPLQKSFTCDLALTATISGTTFLLLNAIF 137 >AE014134-94|AAN10496.1| 476|Drosophila melanogaster CG11907-PB, isoform B protein. Length = 476 Score = 28.7 bits (61), Expect = 8.8 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = -3 Query: 469 WSVWIACNFYWSLFYLYQRFVFNTGLFATQITYL*TSKKLQHVIVALLNGTFLILLGAVF 290 W+ ++ YW Y ++ N ++T L S + A ++GT +LL A+F Sbjct: 80 WNFFVTAEDYWK--YKFRNASINNTDLEEELTPLQKSFTCDLALTATISGTTFLLLNAIF 137 >AE014134-93|AAF51506.2| 476|Drosophila melanogaster CG11907-PA, isoform A protein. Length = 476 Score = 28.7 bits (61), Expect = 8.8 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = -3 Query: 469 WSVWIACNFYWSLFYLYQRFVFNTGLFATQITYL*TSKKLQHVIVALLNGTFLILLGAVF 290 W+ ++ YW Y ++ N ++T L S + A ++GT +LL A+F Sbjct: 80 WNFFVTAEDYWK--YKFRNASINNTDLEEELTPLQKSFTCDLALTATISGTTFLLLNAIF 137 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,740,623 Number of Sequences: 53049 Number of extensions: 562754 Number of successful extensions: 883 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 883 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3375989364 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -