BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0010 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1E8.02 |||ubiquitin family protein, unknown|Schizosaccharomy... 26 6.0 SPBC31E1.05 |gle1||RNA export factor Gle1 |Schizosaccharomyces p... 25 7.9 >SPBC1E8.02 |||ubiquitin family protein, unknown|Schizosaccharomyces pombe|chr 2|||Manual Length = 603 Score = 25.8 bits (54), Expect = 6.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 40 ASGTAPTGSSVQKRPRSANSFKKKRRHPPRLNNVDRSS 153 ASG GS+ PRS NSF + P L+ VD ++ Sbjct: 240 ASGNLALGSNSGLNPRSPNSFSSPLDN-PALHTVDSTN 276 >SPBC31E1.05 |gle1||RNA export factor Gle1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 480 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 73 QKRPRSANSFKKKRRHPPRLNNVDRSSAQTREVT 174 +K+ F +KR+ PRL + +S++Q ++T Sbjct: 219 EKKELKNYCFTQKRKITPRLGQITKSNSQIMKIT 252 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,740,055 Number of Sequences: 5004 Number of extensions: 53272 Number of successful extensions: 144 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -