BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0010 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10620.1 68414.m01204 protein kinase family protein contains ... 33 0.24 At3g51540.1 68416.m05644 expressed protein mucin 5AC, Homo sapie... 31 0.97 At1g56020.1 68414.m06431 expressed protein 31 0.97 At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein ... 29 2.2 At4g02720.1 68417.m00368 expressed protein temporary automated f... 29 3.0 At5g11770.1 68418.m01374 NADH-ubiquinone oxidoreductase 20 kDa s... 28 5.2 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 5.2 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 5.2 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 28 6.8 At3g11760.1 68416.m01443 expressed protein 28 6.8 At2g37440.2 68415.m04593 endonuclease/exonuclease/phosphatase fa... 27 9.0 At2g37440.1 68415.m04592 endonuclease/exonuclease/phosphatase fa... 27 9.0 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = +2 Query: 281 STPDPAPA*QSSQHDTLPVVGPLVSPHGQVPPPRLFLP 394 S P P P QS+ PVV P P Q+PPP LF P Sbjct: 95 SPPQPQPPPQSTPTGDSPVVIPFPKP--QLPPPSLFPP 130 >At3g51540.1 68416.m05644 expressed protein mucin 5AC, Homo sapiens, PIR:S53363 Length = 438 Score = 30.7 bits (66), Expect = 0.97 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 7 PRLNPALVAAQASGTAPTGSSVQKRPRSANSFKKKRRHPPRL 132 PR P + A +S T SSV RP + + R PPRL Sbjct: 200 PRAKPQIAANASSRTNVRSSSVTSRPDRSTTVSATPRTPPRL 241 >At1g56020.1 68414.m06431 expressed protein Length = 398 Score = 30.7 bits (66), Expect = 0.97 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +1 Query: 7 PRLNPALVAAQASGTAP--TGSSVQKRPRSANSFKKKRRHPPRLNNVDRSSAQTREVTVS 180 PRL+ L A+ AP T S +PR + K +R HPP +VD SS+ + + Sbjct: 223 PRLSLDLDKPSANPFAPSRTHSRNLNQPRIRLA-KPRRNHPPSTPSVDGSSSSSACIESR 281 Query: 181 GVTV 192 G+TV Sbjct: 282 GLTV 285 >At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 718 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 7 PRLNPALVAAQASGTAPTGSSVQKRPRSANSFKKKRRHPPRLNNVDRSSAQTR 165 PR+ P+ V A+ TA G+ + KRP +++K + + N R++A+ R Sbjct: 375 PRMVPSTVDPDAAETAERGNKIPKRPVKISAWKLAKLNS---NEATRAAARAR 424 >At4g02720.1 68417.m00368 expressed protein temporary automated functional assignment Length = 422 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 64 SSVQKRPRSANSFKKKRRH--PPRLNNVDRSSAQTREVTVS 180 SS +K+ RS+ SF+KKR H + ++ D SS + + +S Sbjct: 156 SSKRKKSRSSRSFRKKRSHRRKTKYSDSDESSDEDSKAEIS 196 >At5g11770.1 68418.m01374 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial identical to NADH-ubiquinone oxidoreductase 20 kDa subunit mitochondrial [precursor] SP:Q42577 from [Arabidopsis thaliana]; contains Pfam profile: PF01058 NADH ubiquinone oxidoreductase, 20 Kd subunit Length = 218 Score = 28.3 bits (60), Expect = 5.2 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +2 Query: 233 ARVTLNLQTTRDLDLQSTPDPAPA*QSSQHDTLPVVGPLVSPHGQVPP 376 A +T N T L LQS A A S H +LP + P SP P Sbjct: 2 AMITRNTATRLPLLLQSQRAVAAASVSHLHTSLPALSPSTSPTSYTRP 49 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = +2 Query: 287 PDPAPA*QSSQHDTL----PVVGPLVSPHGQVPPP 379 P P+ A QHD+ PV G ++ P+G+ PPP Sbjct: 329 PIPSSAQSIPQHDSSMAIPPVSGHIMPPYGRFPPP 363 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 4/35 (11%) Frame = +2 Query: 287 PDPAPA*QSSQHDTL----PVVGPLVSPHGQVPPP 379 P P+ A QHD+ PV G ++ P+G+ PPP Sbjct: 316 PIPSSAQSIPQHDSSMAIPPVSGHIMPPYGRFPPP 350 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 27.9 bits (59), Expect = 6.8 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 13 LNPALV-AAQASGTAPTGSSVQKRPRSANSFKKKRRHPPRLNNVDRSSAQTREVT 174 LNP + A + P S KR +K R+H NN+DR +A T+EV+ Sbjct: 1226 LNPQICDALSIANDVPVSHSHPKRMFDFVYRRKSRKHK---NNLDRDAALTKEVS 1277 >At3g11760.1 68416.m01443 expressed protein Length = 702 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 290 RVCSGDQGR-ASFEDSTSLELLETDF 216 + C ++GR +SFE S SL+ ETDF Sbjct: 236 KACREEEGRFSSFESSESLDDFETDF 261 >At2g37440.2 68415.m04593 endonuclease/exonuclease/phosphatase family protein similar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 398 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 126 ETQQRGPQLGPNQRGNSEWRYRCHNRIQTEEI 221 ++ ++ + N R N Y CH ++Q EEI Sbjct: 346 QSNRKTKPVNQNHRPNPVLTYTCHGKVQAEEI 377 >At2g37440.1 68415.m04592 endonuclease/exonuclease/phosphatase family protein similar to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 479 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 126 ETQQRGPQLGPNQRGNSEWRYRCHNRIQTEEI 221 ++ ++ + N R N Y CH ++Q EEI Sbjct: 427 QSNRKTKPVNQNHRPNPVLTYTCHGKVQAEEI 458 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,855,668 Number of Sequences: 28952 Number of extensions: 302077 Number of successful extensions: 785 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -