BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0009 (579 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40799-3|AAA81481.1| 323|Caenorhabditis elegans Hypothetical pr... 33 0.11 Z66519-14|CAA91377.2| 1146|Caenorhabditis elegans Hypothetical p... 27 7.3 U56101-1|AAC47459.1| 1167|Caenorhabditis elegans AGE-1 protein. 27 7.3 AL110499-5|CAB57914.1| 1146|Caenorhabditis elegans Hypothetical ... 27 7.3 Z81453-6|CAH04639.1| 283|Caenorhabditis elegans Hypothetical pr... 27 9.6 >U40799-3|AAA81481.1| 323|Caenorhabditis elegans Hypothetical protein F42C5.5 protein. Length = 323 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 152 LHLSLFR*DYGICILSQANNDSIGLRKIYLLWI 250 +H + FR YG ++SQA NDS ++L+WI Sbjct: 78 VHANTFRTPYGNFLISQAPNDSTNADHLHLMWI 110 >Z66519-14|CAA91377.2| 1146|Caenorhabditis elegans Hypothetical protein B0334.8 protein. Length = 1146 Score = 27.5 bits (58), Expect = 7.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 403 CVDVYKFIWSNEKLFIHIRTI 465 CV+ Y+ +W+N LF+ + T+ Sbjct: 1064 CVEAYEVMWNNRDLFVSLFTL 1084 >U56101-1|AAC47459.1| 1167|Caenorhabditis elegans AGE-1 protein. Length = 1167 Score = 27.5 bits (58), Expect = 7.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 403 CVDVYKFIWSNEKLFIHIRTI 465 CV+ Y+ +W+N LF+ + T+ Sbjct: 1085 CVEAYEVMWNNRDLFVSLFTL 1105 >AL110499-5|CAB57914.1| 1146|Caenorhabditis elegans Hypothetical protein B0334.8 protein. Length = 1146 Score = 27.5 bits (58), Expect = 7.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 403 CVDVYKFIWSNEKLFIHIRTI 465 CV+ Y+ +W+N LF+ + T+ Sbjct: 1064 CVEAYEVMWNNRDLFVSLFTL 1084 >Z81453-6|CAH04639.1| 283|Caenorhabditis elegans Hypothetical protein B0250.10 protein. Length = 283 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -3 Query: 400 TLDILILMLFF*TIRVMSKIVIYNYRFSIVINFMSL 293 T+ ILIL ++F ++ + +I N FS+VI S+ Sbjct: 56 TVVILILKIYFLLTQISTDFIIKNVHFSLVIPAASI 91 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,061,882 Number of Sequences: 27780 Number of extensions: 200820 Number of successful extensions: 312 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1205362812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -