BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0004 (595 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC970.07c |raf2|dos2, cmc2, clr7|Rik1-associated factor Raf2|S... 29 0.39 SPAC31A2.06 |||conserved fungal protein|Schizosaccharomyces pomb... 26 3.6 SPAC869.03c |||urea transporter |Schizosaccharomyces pombe|chr 1... 26 3.6 SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos... 25 6.3 >SPCC970.07c |raf2|dos2, cmc2, clr7|Rik1-associated factor Raf2|Schizosaccharomyces pombe|chr 3|||Manual Length = 636 Score = 29.5 bits (63), Expect = 0.39 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 378 CLYFNQASNPSKQSNVMHRHIINFI--KFIW 292 CLYF NP K S V++ H++ + KFI+ Sbjct: 584 CLYFAVCDNPYKPSQVIYDHLLGHVDSKFIF 614 >SPAC31A2.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 26.2 bits (55), Expect = 3.6 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 3/79 (3%) Frame = +2 Query: 302 FIKFMICLCITLLCLDGFEAWLKYKHRTACLERLSTYNGKKIILATKQLKDWFV---NKW 472 F+KFMIC C+ + G E+ +R LER+ G + + T L + + N+W Sbjct: 391 FLKFMICSCM----VKG-ESNFFLDNRIFLLERIMNRYGIPMTIDTFLLMQFILAKSNRW 445 Query: 473 CEFIYIRQTNHTKAFLLAN 529 E ++ R N KA ++ N Sbjct: 446 SE-VWRRWDNLRKAGVVFN 463 >SPAC869.03c |||urea transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 661 Score = 26.2 bits (55), Expect = 3.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 349 WI*SLVKIQTQNCVFGKTFNLQWKKNN 429 WI + + I VFG T L WKK N Sbjct: 425 WIITFIGIALGPAVFGITLTLFWKKMN 451 >SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.4 bits (53), Expect = 6.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 285 THTKNITLLIIINDTDSQICFHRIISSNKP 196 T+TK +T LII+N+ D +R P Sbjct: 36 TYTKTLTSLIIVNEGDEPQNTYRYFQQTSP 65 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,428,790 Number of Sequences: 5004 Number of extensions: 49830 Number of successful extensions: 112 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -