Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0024_P12
         (293 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    21   4.2  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    20   7.3  

>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 20.6 bits (41), Expect = 4.2
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -2

Query: 139 VWLAEIWRVPP 107
           V+LAEIW V P
Sbjct: 557 VFLAEIWDVTP 567


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 19.8 bits (39), Expect = 7.3
 Identities = 10/35 (28%), Positives = 18/35 (51%)
 Frame = +2

Query: 125 FGQPDYRVYELNKRLQQRTEDSDNLWWDAFATEFF 229
           FG   Y  Y ++ R   +TEDS+ +      T+++
Sbjct: 163 FGSWTYDGYTVDLRHLAQTEDSNQIEVGIDLTDYY 197


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 53,228
Number of Sequences: 438
Number of extensions: 732
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used:  5994288
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)