SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0024_P08
         (161 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex det...    20   3.2  
DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex det...    20   3.2  
DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex det...    20   3.2  
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    20   3.2  
DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex det...    20   3.2  
DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex det...    20   3.2  
DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex det...    20   3.2  
DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly pro...    20   3.2  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    20   3.2  
AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    20   3.2  
AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter...    20   3.2  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    19   7.4  

>DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 60  RCKSPKGISS 31
           RCK PK ISS
Sbjct: 75  RCKEPKIISS 84


>DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 60  RCKSPKGISS 31
           RCK PK ISS
Sbjct: 75  RCKEPKIISS 84


>DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 60  RCKSPKGISS 31
           RCK PK ISS
Sbjct: 75  RCKEPKIISS 84


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 60  RCKSPKGISS 31
           RCK PK ISS
Sbjct: 75  RCKEPKIISS 84


>DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 60  RCKSPKGISS 31
           RCK PK ISS
Sbjct: 75  RCKEPKIISS 84


>DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 60  RCKSPKGISS 31
           RCK PK ISS
Sbjct: 75  RCKEPKIISS 84


>DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 60  RCKSPKGISS 31
           RCK PK ISS
Sbjct: 75  RCKEPKIISS 84


>DQ000307-1|AAY21180.1|  423|Apis mellifera major royal jelly
           protein 9 protein.
          Length = 423

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 6/18 (33%), Positives = 12/18 (66%)
 Frame = -3

Query: 96  LNSAFDAILNVIRCKSPK 43
           LN+  + ++   RC++PK
Sbjct: 398 LNAPVNQLIRYTRCENPK 415


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +2

Query: 11   SNVLVLPELMPLGDLHRITFKMASKAEFSLCLLRPYPGR 127
            S VLVL  ++ L  + R +    + +++ L  LR  PG+
Sbjct: 1003 SGVLVLLVIIVLAFVFRESVGAWAYSKYGLRFLRAKPGK 1041


>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = +2

Query: 101 CLLRPYP 121
           CLL+PYP
Sbjct: 106 CLLQPYP 112


>AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter
           Am-EAAT protein.
          Length = 543

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = -3

Query: 90  SAFDAILNVIRCKSPKGI 37
           S  DAIL++IR   P+ +
Sbjct: 182 STLDAILDIIRNMVPENL 199


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 18.6 bits (36), Expect = 7.4
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 101 CLLRPYPG 124
           CL+ P+PG
Sbjct: 7   CLVAPFPG 14


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 41,781
Number of Sequences: 438
Number of extensions: 786
Number of successful extensions: 12
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 33
effective length of database: 131,889
effective search space used:  2637780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.9 bits)

- SilkBase 1999-2023 -