Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0024_N24
         (144 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ219482-1|ABB29886.1|  545|Anopheles gambiae cryptochrome 1 pro...    24   0.75 
AF487781-1|AAL96668.1|  533|Anopheles gambiae cytochrome P450 CY...    21   4.0  
AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p...    20   9.2  

>DQ219482-1|ABB29886.1|  545|Anopheles gambiae cryptochrome 1
           protein.
          Length = 545

 Score = 23.8 bits (49), Expect = 0.75
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = +1

Query: 13  VGISHLKGLFNNHEDLGRLRRAIGGSACGYQPPSIT 120
           VG + +K L  +  DL R  R +GG    ++  S+T
Sbjct: 55  VGYNRMKFLLESLADLDRQFRDLGGQLLVFRGDSVT 90


>AF487781-1|AAL96668.1|  533|Anopheles gambiae cytochrome P450
           CYP9L1 protein protein.
          Length = 533

 Score = 21.4 bits (43), Expect = 4.0
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 54  RPWSPSPG 77
           R WSPSPG
Sbjct: 395 RKWSPSPG 402


>AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein
           protein.
          Length = 1077

 Score = 20.2 bits (40), Expect = 9.2
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 97  GYQPPSIT 120
           GYQPPS T
Sbjct: 905 GYQPPSAT 912


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 131,938
Number of Sequences: 2352
Number of extensions: 1919
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 563,979
effective HSP length: 27
effective length of database: 500,475
effective search space used: 10009500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)