SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0024_M09
         (163 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-3313|AAF46788.1|  404|Drosophila melanogaster CG13500-P...    27   2.7  

>AE013599-3313|AAF46788.1|  404|Drosophila melanogaster CG13500-PA
           protein.
          Length = 404

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 4/56 (7%)
 Frame = -3

Query: 158 QSCQNI*LNY---TVSSIHKLNINLIF-LPIIDTYIVYHTLVSVSHSCRKILQPRG 3
           +SC  + L Y   TVS +  L     F L ++D Y +   L  V  SC  ++QPRG
Sbjct: 41  ESCNELRLTYYSVTVSRMIGLWCAFFFTLALLDPYPLMLHLQLVGFSCWLLIQPRG 96


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,791,597
Number of Sequences: 53049
Number of extensions: 94101
Number of successful extensions: 143
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 143
length of database: 24,988,368
effective HSP length: 34
effective length of database: 23,184,702
effective search space used: 440509338
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -