SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0024_I11
         (331 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   5.1  
AY273778-1|AAP33487.1|  427|Apis mellifera ultraspiracle protein...    21   5.1  
AF263459-1|AAF73057.1|  427|Apis mellifera ultraspiracle protein...    21   5.1  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    20   6.7  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    20   6.7  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    20   6.7  
AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precur...    20   8.9  
AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9 methylt...    20   8.9  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 20.6 bits (41), Expect = 5.1
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = +1

Query: 217  HNG*RGVPIGHDAKA 261
            H+G  G P+GH   A
Sbjct: 1755 HSGTMGPPVGHPTNA 1769


>AY273778-1|AAP33487.1|  427|Apis mellifera ultraspiracle protein
           protein.
          Length = 427

 Score = 20.6 bits (41), Expect = 5.1
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 200 RGSNWLSLNDS 168
           RG+ WLSL++S
Sbjct: 25  RGNTWLSLDNS 35


>AF263459-1|AAF73057.1|  427|Apis mellifera ultraspiracle protein
           protein.
          Length = 427

 Score = 20.6 bits (41), Expect = 5.1
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -3

Query: 200 RGSNWLSLNDS 168
           RG+ WLSL++S
Sbjct: 25  RGNTWLSLDNS 35


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 20.2 bits (40), Expect = 6.7
 Identities = 4/9 (44%), Positives = 8/9 (88%)
 Frame = +3

Query: 126 IWRWLKVPY 152
           +WRW+++ Y
Sbjct: 58  LWRWIRLTY 66


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 20.2 bits (40), Expect = 6.7
 Identities = 4/9 (44%), Positives = 8/9 (88%)
 Frame = +3

Query: 126 IWRWLKVPY 152
           +WRW+++ Y
Sbjct: 96  LWRWIRLTY 104


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 20.2 bits (40), Expect = 6.7
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 3/48 (6%)
 Frame = -3

Query: 269 PCGAFASCPIGTPLHPLCHHASE---RGSNWLSLNDSPQLNPVRHLEP 135
           P G+  +   G  L P    A +   R  +WL+  +SP  +P   L+P
Sbjct: 58  PVGSAVAGTAGGALFPGMAAAGKGAARSDDWLANANSPVGSPSAALQP 105


>AY127579-1|AAN02286.1|  405|Apis mellifera venom protease precursor
           protein.
          Length = 405

 Score = 19.8 bits (39), Expect = 8.9
 Identities = 11/33 (33%), Positives = 16/33 (48%)
 Frame = -3

Query: 131 PYYCMILHGSA*LFSLPPIHRIERK**LVHYQE 33
           P Y +   GS   +++   HRI  K  LV + E
Sbjct: 59  PRYPLPYSGSKCTWTITSYHRINLKCSLVEFSE 91


>AM050259-1|CAJ18340.1|  683|Apis mellifera putative H3K9
           methyltransferase protein.
          Length = 683

 Score = 19.8 bits (39), Expect = 8.9
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 7   GRGWYVKT 30
           GRGW VKT
Sbjct: 505 GRGWGVKT 512


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,895
Number of Sequences: 438
Number of extensions: 2299
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  7342137
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -