BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0024_E04
(429 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 2.6
AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 6.1
>AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450
CYP9L1 protein protein.
Length = 533
Score = 23.8 bits (49), Expect = 2.6
Identities = 14/40 (35%), Positives = 22/40 (55%)
Frame = +1
Query: 223 EIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAK 342
E+F+++ Q +E+ I D I L QAR Y P E++
Sbjct: 255 EMFRQSVQEREEHGIVRPDLIHLLIQARKGQLRYQPQESE 294
>AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase
protein.
Length = 849
Score = 22.6 bits (46), Expect = 6.1
Identities = 6/11 (54%), Positives = 10/11 (90%)
Frame = -3
Query: 406 AIPCVPWVILG 374
A+ C+PW++LG
Sbjct: 649 ALLCIPWMLLG 659
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 435,486
Number of Sequences: 2352
Number of extensions: 7915
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 35292513
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -