SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0024_B17
         (284 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY545000-1|AAS50159.2|  126|Apis mellifera profilin protein.           21   3.9  
AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    20   6.8  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    19   9.0  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          19   9.0  

>AY545000-1|AAS50159.2|  126|Apis mellifera profilin protein.
          Length = 126

 Score = 20.6 bits (41), Expect = 3.9
 Identities = 10/31 (32%), Positives = 15/31 (48%)
 Frame = +1

Query: 67  GHQ*NQYLPSSTMSVDKEELVQRAKLAEQAE 159
           GH  N +  S    V KEEL +  +  E+ +
Sbjct: 24  GHDGNLWAKSEGFEVSKEELTKLVQGFEEQD 54


>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 19.8 bits (39), Expect = 6.8
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -3

Query: 261 HIFISNGKKVSFF 223
           +IF   GKK +FF
Sbjct: 242 NIFFPGGKKTTFF 254


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 19.4 bits (38), Expect = 9.0
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +3

Query: 219 QRRKKPSFRC 248
           +RR +P+FRC
Sbjct: 414 RRRYQPAFRC 423


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 19.4 bits (38), Expect = 9.0
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -2

Query: 103 SWTMEDID 80
           SWT ED+D
Sbjct: 410 SWTQEDMD 417


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,879
Number of Sequences: 438
Number of extensions: 1421
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used:  5619645
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -