BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0024_B17
(284 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 21 3.9
AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 20 6.8
AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 19 9.0
AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 19 9.0
>AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein.
Length = 126
Score = 20.6 bits (41), Expect = 3.9
Identities = 10/31 (32%), Positives = 15/31 (48%)
Frame = +1
Query: 67 GHQ*NQYLPSSTMSVDKEELVQRAKLAEQAE 159
GH N + S V KEEL + + E+ +
Sbjct: 24 GHDGNLWAKSEGFEVSKEELTKLVQGFEEQD 54
>AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate
dehydrogenase protein.
Length = 363
Score = 19.8 bits (39), Expect = 6.8
Identities = 7/13 (53%), Positives = 9/13 (69%)
Frame = -3
Query: 261 HIFISNGKKVSFF 223
+IF GKK +FF
Sbjct: 242 NIFFPGGKKTTFF 254
>AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type
D2 protein.
Length = 456
Score = 19.4 bits (38), Expect = 9.0
Identities = 6/10 (60%), Positives = 9/10 (90%)
Frame = +3
Query: 219 QRRKKPSFRC 248
+RR +P+FRC
Sbjct: 414 RRRYQPAFRC 423
>AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein.
Length = 652
Score = 19.4 bits (38), Expect = 9.0
Identities = 6/8 (75%), Positives = 7/8 (87%)
Frame = -2
Query: 103 SWTMEDID 80
SWT ED+D
Sbjct: 410 SWTQEDMD 417
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,879
Number of Sequences: 438
Number of extensions: 1421
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used: 5619645
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)
- SilkBase 1999-2023 -