SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0023_H16
         (402 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    21   5.3  
AB201717-1|BAD90662.1|  107|Apis mellifera apime-corazonin prepr...    21   5.3  
DQ384991-1|ABD51779.1|   94|Apis mellifera allergen Api m 6 vari...    20   9.2  
DQ384990-1|ABD51778.1|   92|Apis mellifera allergen Api m 6 vari...    20   9.2  

>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 21.0 bits (42), Expect = 5.3
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -1

Query: 108 LCKERREHLVREVIR 64
           LC E  E LVR++ R
Sbjct: 22  LCSEDEERLVRDLFR 36


>AB201717-1|BAD90662.1|  107|Apis mellifera apime-corazonin
           preprohormone protein.
          Length = 107

 Score = 21.0 bits (42), Expect = 5.3
 Identities = 14/43 (32%), Positives = 18/43 (41%)
 Frame = -2

Query: 365 ILSQPIS*VVNGAQTYCHNINNRCRSLSCALRTNSKSYHEKNI 237
           ILS  I+ V+    TY H   N  RS S     N  +    N+
Sbjct: 11  ILSLTITIVMCQTFTYSHGWTNGKRSTSLEELANRNAIQSDNV 53


>DQ384991-1|ABD51779.1|   94|Apis mellifera allergen Api m 6 variant
           2 precursor protein.
          Length = 94

 Score = 20.2 bits (40), Expect = 9.2
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +3

Query: 321 CLCAIHYLRN 350
           C+C + YLRN
Sbjct: 71  CVCRLGYLRN 80


>DQ384990-1|ABD51778.1|   92|Apis mellifera allergen Api m 6 variant
           1 precursor protein.
          Length = 92

 Score = 20.2 bits (40), Expect = 9.2
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +3

Query: 321 CLCAIHYLRN 350
           C+C + YLRN
Sbjct: 71  CVCRLGYLRN 80


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 114,719
Number of Sequences: 438
Number of extensions: 2310
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10008927
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -