SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0023_G21
         (384 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL110499-3|CAE18038.1|  437|Caenorhabditis elegans Hypothetical ...    30   0.49 
Z78415-4|CAB01673.2|  281|Caenorhabditis elegans Hypothetical pr...    27   4.5  

>AL110499-3|CAE18038.1|  437|Caenorhabditis elegans Hypothetical
           protein Y62F5A.10 protein.
          Length = 437

 Score = 30.3 bits (65), Expect = 0.49
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 7/74 (9%)
 Frame = +2

Query: 14  EKIPITVITVCKLKHKYDYIDPCTRKSFLYR-------RRSSK*QVTVSNYTAASVPNGF 172
           E++ +  + V     KYD+  P T  SFLY        R+  K     S YT   +PNGF
Sbjct: 236 EQVVMMYVLVGSEDEKYDFF-PKTTGSFLYYGEMFVNVRKVEKMDEERSRYTIEVLPNGF 294

Query: 173 NTIHYI*VILYTGF 214
           +    + V ++TG+
Sbjct: 295 SNSVMMNVYVHTGW 308


>Z78415-4|CAB01673.2|  281|Caenorhabditis elegans Hypothetical
           protein C17G1.5 protein.
          Length = 281

 Score = 27.1 bits (57), Expect = 4.5
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +1

Query: 7   GVREDSHYCYYC 42
           G+ +D H+CYYC
Sbjct: 127 GIDDDDHWCYYC 138


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,263,979
Number of Sequences: 27780
Number of extensions: 154879
Number of successful extensions: 316
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 311
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 316
length of database: 12,740,198
effective HSP length: 74
effective length of database: 10,684,478
effective search space used: 566277334
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -