BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0023_E18
(208 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB037726-1|BAA92543.2| 1819|Homo sapiens KIAA1305 protein protein. 30 1.6
>AB037726-1|BAA92543.2| 1819|Homo sapiens KIAA1305 protein protein.
Length = 1819
Score = 29.9 bits (64), Expect = 1.6
Identities = 19/67 (28%), Positives = 28/67 (41%)
Frame = +2
Query: 5 EAFEDSKSGLANATLLAHPNPRAHLAIMTDASDSAIGAVLQQKSDSGWVPLGFFSKKLNN 184
EAF K L +A L PN + + S A+ A+L Q+ P+ + SK L
Sbjct: 1057 EAFLALKRALVSALCLMAPNSQLPFRLEVTVSHVALTAILHQEHSGRKHPIAYTSKPLLP 1116
Query: 185 AQRKYSP 205
+ P
Sbjct: 1117 DEESQGP 1123
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,993,656
Number of Sequences: 237096
Number of extensions: 408552
Number of successful extensions: 1005
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 971
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1005
length of database: 76,859,062
effective HSP length: 47
effective length of database: 65,715,550
effective search space used: 1380026550
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -