SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0023_C10
         (369 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    21   4.6  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        21   4.6  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        21   4.6  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        21   4.6  
AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ...    21   4.6  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   6.1  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   6.1  
DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    20   8.1  
DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride...    20   8.1  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    20   8.1  
DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride...    20   8.1  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    20   8.1  
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    20   8.1  

>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 21.0 bits (42), Expect = 4.6
 Identities = 11/40 (27%), Positives = 19/40 (47%)
 Frame = +2

Query: 77  AQARESSSRAAMGRQGIQKSPHGYEMEGEPLRWCISC*GH 196
           A + E+S+ A    + + K P  + +     RW  SC G+
Sbjct: 34  ATSHEASAPAEGKFKTVSKVPGPFSLPIFGTRWIFSCIGY 73


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.0 bits (42), Expect = 4.6
 Identities = 10/16 (62%), Positives = 10/16 (62%), Gaps = 2/16 (12%)
 Frame = -1

Query: 90  SRACAPCEYPEV--YP 49
           S  CA CE PEV  YP
Sbjct: 216 SNMCALCEKPEVCDYP 231


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.0 bits (42), Expect = 4.6
 Identities = 10/16 (62%), Positives = 10/16 (62%), Gaps = 2/16 (12%)
 Frame = -1

Query: 90  SRACAPCEYPEV--YP 49
           S  CA CE PEV  YP
Sbjct: 216 SNMCALCEKPEVCDYP 231


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 21.0 bits (42), Expect = 4.6
 Identities = 10/16 (62%), Positives = 10/16 (62%), Gaps = 2/16 (12%)
 Frame = -1

Query: 90  SRACAPCEYPEV--YP 49
           S  CA CE PEV  YP
Sbjct: 216 SNMCALCEKPEVCDYP 231


>AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein
           protein.
          Length = 1124

 Score = 21.0 bits (42), Expect = 4.6
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = +1

Query: 232 PNSALRKCV 258
           PNSA+RKC+
Sbjct: 584 PNSAVRKCM 592


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
           AbsCAM-Ig7B protein.
          Length = 1923

 Score = 20.6 bits (41), Expect = 6.1
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +1

Query: 139 TWVRDGRRTP 168
           TW +DGR+ P
Sbjct: 366 TWYKDGRQLP 375


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
           AbsCAM-Ig7A protein.
          Length = 1919

 Score = 20.6 bits (41), Expect = 6.1
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +1

Query: 139 TWVRDGRRTP 168
           TW +DGR+ P
Sbjct: 366 TWYKDGRQLP 375


>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 20.2 bits (40), Expect = 8.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -2

Query: 365 PNPATHTSS 339
           PNP THT++
Sbjct: 432 PNPCTHTTT 440


>DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride
           channel variant 3 protein.
          Length = 475

 Score = 20.2 bits (40), Expect = 8.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -2

Query: 365 PNPATHTSS 339
           PNP THT++
Sbjct: 418 PNPCTHTTT 426


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 20.2 bits (40), Expect = 8.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -2

Query: 365 PNPATHTSS 339
           PNP THT++
Sbjct: 452 PNPCTHTTT 460


>DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride
           channel protein.
          Length = 458

 Score = 20.2 bits (40), Expect = 8.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -2

Query: 365 PNPATHTSS 339
           PNP THT++
Sbjct: 401 PNPCTHTTT 409


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 20.2 bits (40), Expect = 8.1
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -2

Query: 38  ANTIGSSCRIH 6
           A  +GS+CRIH
Sbjct: 435 AVNLGSACRIH 445


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 20.2 bits (40), Expect = 8.1
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -1

Query: 156 SISYPCGLF*IPCRPIAARD 97
           ++SY  G + IP   I++RD
Sbjct: 113 AVSYTSGFYHIPVIGISSRD 132


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,393
Number of Sequences: 438
Number of extensions: 2114
Number of successful extensions: 13
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8804355
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -