Samia BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0023_B22
         (203 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-698|AAF46000.1|  150|Drosophila melanogaster CG12680-PA...    27   4.8  
AY089394-1|AAL90132.1|  250|Drosophila melanogaster AT21920p pro...    26   8.3  
AE013599-2228|AAF58034.2|  250|Drosophila melanogaster CG15708-P...    26   8.3  

>AE014298-698|AAF46000.1|  150|Drosophila melanogaster CG12680-PA
           protein.
          Length = 150

 Score = 26.6 bits (56), Expect = 4.8
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +2

Query: 11  RARQGADACFVCVATPSNEYLIIDVVHLVCMCF 109
           R + G    F C+   +NE + +DV H+ C  F
Sbjct: 42  RIQVGDTNTFFCLDDSTNETIKLDVAHMYCFPF 74


>AY089394-1|AAL90132.1|  250|Drosophila melanogaster AT21920p
           protein.
          Length = 250

 Score = 25.8 bits (54), Expect = 8.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 16  APGRGRMFCVCC 51
           AP  GR+FC CC
Sbjct: 151 APAEGRIFCPCC 162


>AE013599-2228|AAF58034.2|  250|Drosophila melanogaster CG15708-PA
           protein.
          Length = 250

 Score = 25.8 bits (54), Expect = 8.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 16  APGRGRMFCVCC 51
           AP  GR+FC CC
Sbjct: 151 APAEGRIFCPCC 162


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,709,777
Number of Sequences: 53049
Number of extensions: 137999
Number of successful extensions: 275
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 275
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 275
length of database: 24,988,368
effective HSP length: 47
effective length of database: 22,495,065
effective search space used: 449901300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)