SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0022_P24
         (285 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    21   2.6  
AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    20   5.9  
AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory recept...    20   5.9  

>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 21.0 bits (42), Expect = 2.6
 Identities = 16/62 (25%), Positives = 27/62 (43%)
 Frame = +1

Query: 73  TLCGHNGWITQIATNPKYPDMILSSSRDKTLIVWKLTRDETNYGLPQKRLYGHSHFISDV 252
           T  G  G  T + TN     +IL       ++V+  + DET   +   +LY  + F   +
Sbjct: 305 TYFGKTGRKTVLKTNKYCNFIILFYLSVFVILVYYASLDETPNPVTNGKLYNFNTFAKLL 364

Query: 253 VL 258
           +L
Sbjct: 365 IL 366


>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 19.8 bits (39), Expect = 5.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 283 KERNLHHW 260
           KERN +HW
Sbjct: 153 KERNSNHW 160


>AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory receptor
           candidate 14 protein.
          Length = 374

 Score = 19.8 bits (39), Expect = 5.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 283 KERNLHHW 260
           KERN +HW
Sbjct: 109 KERNSNHW 116


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 67,625
Number of Sequences: 336
Number of extensions: 1326
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 48
effective length of database: 106,457
effective search space used:  4897022
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)

- SilkBase 1999-2023 -