SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0022_M24
         (188 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY825832-1|AAV70395.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825831-1|AAV70394.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825830-1|AAV70393.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825829-1|AAV70392.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825828-1|AAV70391.1|  172|Anopheles gambiae heat shock protein...    22   2.2  
AY825827-1|AAV70390.1|  172|Anopheles gambiae heat shock protein...    22   2.2  
AY825826-1|AAV70389.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825825-1|AAV70388.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825824-1|AAV70387.1|  161|Anopheles gambiae heat shock protein...    22   2.2  
AY825823-1|AAV70386.1|  161|Anopheles gambiae heat shock protein...    22   2.2  
AY825822-1|AAV70385.1|  159|Anopheles gambiae heat shock protein...    22   2.2  
AY825821-1|AAV70384.1|  159|Anopheles gambiae heat shock protein...    22   2.2  
AY825820-1|AAV70383.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825819-1|AAV70382.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825818-1|AAV70381.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825817-1|AAV70380.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825816-1|AAV70379.1|  162|Anopheles gambiae heat shock protein...    22   2.2  
AY825815-1|AAV70378.1|  162|Anopheles gambiae heat shock protein...    22   2.2  
AY825814-1|AAV70377.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825813-1|AAV70376.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825812-1|AAV70375.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825811-1|AAV70374.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825810-1|AAV70373.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825809-1|AAV70372.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825808-1|AAV70371.1|  171|Anopheles gambiae heat shock protein...    22   2.2  
AY825807-1|AAV70370.1|  171|Anopheles gambiae heat shock protein...    22   2.2  
AY825806-1|AAV70369.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825805-1|AAV70368.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825804-1|AAV70367.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825803-1|AAV70366.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825802-1|AAV70365.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825801-1|AAV70364.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825800-1|AAV70363.1|  171|Anopheles gambiae heat shock protein...    22   2.2  
AY825799-1|AAV70362.1|  171|Anopheles gambiae heat shock protein...    22   2.2  
AY825798-1|AAV70361.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825797-1|AAV70360.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825796-1|AAV70359.1|  174|Anopheles gambiae heat shock protein...    22   2.2  
AY825795-1|AAV70358.1|  174|Anopheles gambiae heat shock protein...    22   2.2  
AY825794-1|AAV70357.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825793-1|AAV70356.1|  169|Anopheles gambiae heat shock protein...    22   2.2  
AY825792-1|AAV70355.1|  153|Anopheles gambiae heat shock protein...    22   2.2  
AY825791-1|AAV70354.1|  153|Anopheles gambiae heat shock protein...    22   2.2  
AY825790-1|AAV70353.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825789-1|AAV70352.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825788-1|AAV70351.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825787-1|AAV70350.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825786-1|AAV70349.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825785-1|AAV70348.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825784-1|AAV70347.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825783-1|AAV70346.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825782-1|AAV70345.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY825781-1|AAV70344.1|  168|Anopheles gambiae heat shock protein...    22   2.2  
AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan transpo...    21   3.9  
AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan transpo...    21   3.9  
AF543192-1|AAN40409.1|  636|Anopheles gambiae amino acid transpo...    20   9.0  

>AY825832-1|AAV70395.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825831-1|AAV70394.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825830-1|AAV70393.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825829-1|AAV70392.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825828-1|AAV70391.1|  172|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 172

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825827-1|AAV70390.1|  172|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 172

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825826-1|AAV70389.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825825-1|AAV70388.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825824-1|AAV70387.1|  161|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 161

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 135 VIMVLNDHNYVY 146


>AY825823-1|AAV70386.1|  161|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 161

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 135 VIMVLNDHNYVY 146


>AY825822-1|AAV70385.1|  159|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 159

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 137 VIMVLNDHNYVY 148


>AY825821-1|AAV70384.1|  159|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 159

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 137 VIMVLNDHNYVY 148


>AY825820-1|AAV70383.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825819-1|AAV70382.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825818-1|AAV70381.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825817-1|AAV70380.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825816-1|AAV70379.1|  162|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 162

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 140 VIMVLNDHNYVY 151


>AY825815-1|AAV70378.1|  162|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 162

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 140 VIMVLNDHNYVY 151


>AY825814-1|AAV70377.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825813-1|AAV70376.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825812-1|AAV70375.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825811-1|AAV70374.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825810-1|AAV70373.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825809-1|AAV70372.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825808-1|AAV70371.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825807-1|AAV70370.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825806-1|AAV70369.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825805-1|AAV70368.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825804-1|AAV70367.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825803-1|AAV70366.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825802-1|AAV70365.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825801-1|AAV70364.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825800-1|AAV70363.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825799-1|AAV70362.1|  171|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 171

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 150 VIMVLNDHNYVY 161


>AY825798-1|AAV70361.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825797-1|AAV70360.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825796-1|AAV70359.1|  174|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 174

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 152 VIMVLNDHNYVY 163


>AY825795-1|AAV70358.1|  174|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 174

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 152 VIMVLNDHNYVY 163


>AY825794-1|AAV70357.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825793-1|AAV70356.1|  169|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 169

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825792-1|AAV70355.1|  153|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 153

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 134 VIMVLNDHNYVY 145


>AY825791-1|AAV70354.1|  153|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 153

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 134 VIMVLNDHNYVY 145


>AY825790-1|AAV70353.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825789-1|AAV70352.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825788-1|AAV70351.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825787-1|AAV70350.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825786-1|AAV70349.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825785-1|AAV70348.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825784-1|AAV70347.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825783-1|AAV70346.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825782-1|AAV70345.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY825781-1|AAV70344.1|  168|Anopheles gambiae heat shock protein
           DnaJ protein.
          Length = 168

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 59  VLLVSNEHNYFY 24
           V++V N+HNY Y
Sbjct: 149 VIMVLNDHNYVY 160


>AY536865-1|AAT07965.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 21.4 bits (43), Expect = 3.9
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -1

Query: 116 FEF*TMH*GR*LSIIPFLFVLLVSNEHNYFYNIL 15
           F F  +  G    +IP+L VLL+     Y+  +L
Sbjct: 101 FPFTALENGGGAFVIPYLIVLLLVGRPIYYLEML 134


>AJ626713-1|CAF25029.1|  650|Anopheles gambiae tryptophan
           transporter protein.
          Length = 650

 Score = 21.4 bits (43), Expect = 3.9
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -1

Query: 116 FEF*TMH*GR*LSIIPFLFVLLVSNEHNYFYNIL 15
           F F  +  G    +IP+L VLL+     Y+  +L
Sbjct: 101 FPFTALENGGGAFVIPYLIVLLLVGRPIYYLEML 134


>AF543192-1|AAN40409.1|  636|Anopheles gambiae amino acid
           transporter Ag_AAT8 protein.
          Length = 636

 Score = 20.2 bits (40), Expect = 9.0
 Identities = 9/34 (26%), Positives = 18/34 (52%)
 Frame = -1

Query: 116 FEF*TMH*GR*LSIIPFLFVLLVSNEHNYFYNIL 15
           F F  +  G    +IP++ VLL+  +  Y+  ++
Sbjct: 105 FPFVALENGGGAFVIPYIIVLLLVGKPVYYMEMI 138


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,571
Number of Sequences: 2352
Number of extensions: 2599
Number of successful extensions: 55
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55
length of database: 563,979
effective HSP length: 41
effective length of database: 467,547
effective search space used:  9818487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -