SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0022_M09
         (180 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_06_0143 + 25970745-25970962,25971053-25971140,25971588-259717...    26   3.7  

>05_06_0143 +
           25970745-25970962,25971053-25971140,25971588-25971732,
           25972014-25972101,25972179-25972381,25972774-25972913
          Length = 293

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 9/36 (25%), Positives = 20/36 (55%)
 Frame = -2

Query: 149 HPKNKVLNI*TYNNYNWRIYFKKKYHSM*FEIISKL 42
           H +N +  +     +NW+  F KKY ++ +  ++K+
Sbjct: 222 HVQNSIYQVSPDPGFNWKEAFHKKYAALFYTFLNKV 257


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,204,088
Number of Sequences: 37544
Number of extensions: 34143
Number of successful extensions: 44
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 44
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44
length of database: 14,793,348
effective HSP length: 39
effective length of database: 13,329,132
effective search space used: 266582640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -