SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0022_J19
         (352 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein.    22   5.8  
AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8...    22   7.6  

>AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein.
          Length = 1187

 Score = 22.2 bits (45), Expect = 5.8
 Identities = 10/41 (24%), Positives = 24/41 (58%)
 Frame = +2

Query: 170  DEIISRTRLLDNEIKIMKSEVMRISHEHQAQNDKIRENTEK 292
            D+++ +   L  EIK  ++E+ ++ +E++   D+I    +K
Sbjct: 895  DKLLKQNDELKLEIKKKENEITKVRNENKDGYDRISGMEQK 935


>AJ459961-1|CAD31060.1|  700|Anopheles gambiae prophenoloxidase 8
           protein.
          Length = 700

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -2

Query: 144 LSAFLHPPKWTYL 106
           L AF+H P+ TYL
Sbjct: 385 LLAFIHDPRGTYL 397


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 340,244
Number of Sequences: 2352
Number of extensions: 5440
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 563,979
effective HSP length: 57
effective length of database: 429,915
effective search space used: 25364985
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -