SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0022_I24
         (452 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    22   2.7  
AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.      21   8.3  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                21   8.3  

>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 22.2 bits (45), Expect = 2.7
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 6/36 (16%)
 Frame = -2

Query: 94  LFQVSG-YSF-----DDFVLFNILHCNGTHLALCCL 5
           L+++SG +SF     D +V F++L C  + L LC +
Sbjct: 100 LYEISGNWSFGTIMCDLWVSFDVLSCTASILNLCMI 135


>AJ849455-1|CAH60991.1|  366|Apis mellifera twist protein protein.
          Length = 366

 Score = 20.6 bits (41), Expect = 8.3
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = -2

Query: 64  DFVLFNILHCN 32
           DF LF +LHCN
Sbjct: 302 DF-LFQVLHCN 311


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 20.6 bits (41), Expect = 8.3
 Identities = 6/15 (40%), Positives = 9/15 (60%)
 Frame = +1

Query: 376 WRPYSHHPGQT*PRQ 420
           + P+ HHP Q  P +
Sbjct: 316 YHPHQHHPSQYHPHR 330


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,431
Number of Sequences: 438
Number of extensions: 2254
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11943513
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -