Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0022_D13
         (247 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate r...    20   3.9  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    20   5.2  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    20   5.2  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    20   5.2  
AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.    19   6.9  
DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    19   9.1  

>DQ468657-1|ABE02558.1|  322|Apis mellifera 1,4,5-trisphosphate
           receptor protein.
          Length = 322

 Score = 20.2 bits (40), Expect = 3.9
 Identities = 8/30 (26%), Positives = 16/30 (53%)
 Frame = +2

Query: 20  LGGS*QPRASDEALLLRIRSDRIPVDLYTI 109
           +GG  +PR  ++ LL  +    + +DL  +
Sbjct: 277 IGGQIKPRKHEQRLLRNVGVHTVVLDLLQV 306


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 19.8 bits (39), Expect = 5.2
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -1

Query: 118 LVSYRIEIDWNT 83
           LVS RI++ W T
Sbjct: 127 LVSLRIDLPWRT 138


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 19.8 bits (39), Expect = 5.2
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -1

Query: 118 LVSYRIEIDWNT 83
           LVS RI++ W T
Sbjct: 180 LVSLRIDLPWRT 191


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 19.8 bits (39), Expect = 5.2
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = +3

Query: 15  LGWVGHNSRGR 47
           L W  HN RG+
Sbjct: 87  LAWAKHNPRGK 97


>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score = 19.4 bits (38), Expect = 6.9
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -1

Query: 139 LSTCYRRLVSYRIEIDWNTIRSDP*QQGFVT 47
           L   YRRLV    EI+   + S   + GF+T
Sbjct: 238 LGQVYRRLVHAVNEIEKRLLFSHNDRLGFLT 268


>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 19.0 bits (37), Expect = 9.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 183 ISQVSFVLRKHT 148
           + QVSF L++HT
Sbjct: 233 VLQVSFNLQRHT 244


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,799
Number of Sequences: 438
Number of extensions: 847
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 47
effective length of database: 125,757
effective search space used:  4275738
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)