Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0021_M19
         (113 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z32681-6|CAA83605.1|  257|Caenorhabditis elegans Hypothetical pr...    29   0.33 
AF025457-2|AAB70965.2|  195|Caenorhabditis elegans Hypothetical ...    27   2.3  

>Z32681-6|CAA83605.1|  257|Caenorhabditis elegans Hypothetical
           protein F56F3.5 protein.
          Length = 257

 Score = 29.5 bits (63), Expect = 0.33
 Identities = 9/12 (75%), Positives = 12/12 (100%)
 Frame = +3

Query: 78  VDPFTRKDWYDV 113
           VDPF+RK+WYD+
Sbjct: 20  VDPFSRKEWYDI 31


>AF025457-2|AAB70965.2|  195|Caenorhabditis elegans Hypothetical
           protein C08E3.4 protein.
          Length = 195

 Score = 26.6 bits (56), Expect = 2.3
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = -1

Query: 110 IVPVFTGERINNLLLNTLLASFRKAFIFTDRHDQPR 3
           ++P+F  ER+  L+LN L     K  I  D+  Q R
Sbjct: 59  LLPIFPAERLKKLILNGLDGQEYKQLIDLDQWKQAR 94


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,841,703
Number of Sequences: 27780
Number of extensions: 16146
Number of successful extensions: 28
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 12,740,198
effective HSP length: 19
effective length of database: 12,212,378
effective search space used: 219822804
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)