SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0021_H13
         (362 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       27   0.090
DQ011227-1|AAY63896.1|  484|Apis mellifera Amt-1-like protein pr...    21   3.4  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   3.4  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   3.4  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 26.6 bits (56), Expect = 0.090
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = +3

Query: 87  LGSKYGLMAFCTSKLEVCYFEVNGFYLGKLRGLLGDGNNEPYFDYRLPNGKICT-SESEY 263
           +   +G     T+K +  YF+  G   GK RG +   NN   +     N    T +ESE+
Sbjct: 1   MADDWGKTVSYTNKKDESYFDEGGRSYGKGRGFIIQNNNNDDWSVGKKNSNSGTINESEF 60

Query: 264 GN 269
            +
Sbjct: 61  ND 62


>DQ011227-1|AAY63896.1|  484|Apis mellifera Amt-1-like protein
           protein.
          Length = 484

 Score = 21.4 bits (43), Expect = 3.4
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +1

Query: 1   RWKYSARGAASLSL 42
           RW+Y+AR A S  L
Sbjct: 250 RWQYAARAAISTML 263


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.4 bits (43), Expect = 3.4
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +2

Query: 305  DSRALPPPDARCSA 346
            D  ++PP D RC+A
Sbjct: 1109 DVPSIPPEDVRCAA 1122


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.4 bits (43), Expect = 3.4
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +2

Query: 305  DSRALPPPDARCSA 346
            D  ++PP D RC+A
Sbjct: 1105 DVPSIPPEDVRCAA 1118


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,373
Number of Sequences: 438
Number of extensions: 1912
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8556345
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -