SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0021_F01
         (410 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY524130-1|AAS17758.1|  211|Anopheles gambiae superoxide dismuta...    31   0.022
AY745232-1|AAU93511.1|   75|Anopheles gambiae SOD3A protein.           26   0.47 
X87411-1|CAA60858.1|  599|Anopheles gambiae maltase-like protein...    25   0.81 
EF519384-1|ABP68493.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519383-1|ABP68492.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519381-1|ABP68490.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519380-1|ABP68489.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519376-1|ABP68485.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519374-1|ABP68483.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519373-1|ABP68482.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519372-1|ABP68481.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519371-1|ABP68480.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519370-1|ABP68479.1|  452|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519369-1|ABP68478.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519367-1|ABP68476.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519366-1|ABP68475.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519364-1|ABP68473.1|  496|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519363-1|ABP68472.1|  503|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519362-1|ABP68471.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519361-1|ABP68470.1|  497|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519360-1|ABP68469.1|  499|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519359-1|ABP68468.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519358-1|ABP68467.1|  497|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519357-1|ABP68466.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519356-1|ABP68465.1|  500|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519355-1|ABP68464.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519354-1|ABP68463.1|  506|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519353-1|ABP68462.1|  470|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519352-1|ABP68461.1|  448|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519351-1|ABP68460.1|  486|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519350-1|ABP68459.1|  421|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519349-1|ABP68458.1|  486|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519348-1|ABP68457.1|  503|Anopheles gambiae LRIM1 protein.           22   7.6  
EF519347-1|ABP68456.1|  470|Anopheles gambiae LRIM1 protein.           22   7.6  
AY344814-1|AAR03842.1|  286|Anopheles gambiae LRR Toll protein.        22   7.6  
AY344813-1|AAR03841.1|  286|Anopheles gambiae LRR Toll protein.        22   7.6  
AY344812-1|AAR03840.1|  286|Anopheles gambiae LRR Toll protein.        22   7.6  
AY344811-1|AAR03839.1|  286|Anopheles gambiae LRR Toll protein.        22   7.6  
AY344810-1|AAR03838.1|  286|Anopheles gambiae LRR Toll protein.        22   7.6  
AY344809-1|AAR03837.1|  286|Anopheles gambiae LRR Toll protein.        22   7.6  
AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona...    22   7.6  
AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol ...    22   7.6  

>AY524130-1|AAS17758.1|  211|Anopheles gambiae superoxide dismutase
           2 protein.
          Length = 211

 Score = 30.7 bits (66), Expect = 0.022
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 96  TYFNETQLTLFGPYSILGRSVVIHTRSRD 182
           T +++T ++L+G  S++GR++VIH    D
Sbjct: 116 TSYSDTVVSLYGARSVIGRAIVIHAEVDD 144


>AY745232-1|AAU93511.1|   75|Anopheles gambiae SOD3A protein.
          Length = 75

 Score = 26.2 bits (55), Expect = 0.47
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +3

Query: 111 TQLTLFGPYSILGRSVVIHTRSRD 182
           TQ+ L G  +++GRS+V+H    D
Sbjct: 23  TQIALSGALNVVGRSLVVHADPDD 46


>X87411-1|CAA60858.1|  599|Anopheles gambiae maltase-like protein
           Agm2 protein.
          Length = 599

 Score = 25.4 bits (53), Expect = 0.81
 Identities = 14/56 (25%), Positives = 26/56 (46%)
 Frame = -1

Query: 389 SQVPISNSGISKLNFDNSVAGAAVVVNELRHADVPVREPSWVVERGDATDLASLRG 222
           SQ+P +   I +L+ ++  +    V+N       P   P+WV+   D   ++S  G
Sbjct: 308 SQMPFNFQLIMRLDQNSKASDFQTVINSWLDIIPPGHTPNWVLGNHDKRRVSSRMG 363


>EF519384-1|ABP68493.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519383-1|ABP68492.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519381-1|ABP68490.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519380-1|ABP68489.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519376-1|ABP68485.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519374-1|ABP68483.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519373-1|ABP68482.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519372-1|ABP68481.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519371-1|ABP68480.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519370-1|ABP68479.1|  452|Anopheles gambiae LRIM1 protein.
          Length = 452

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 294 TLGHYGAYCCE 304


>EF519369-1|ABP68478.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519367-1|ABP68476.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519366-1|ABP68475.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519364-1|ABP68473.1|  496|Anopheles gambiae LRIM1 protein.
          Length = 496

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519363-1|ABP68472.1|  503|Anopheles gambiae LRIM1 protein.
          Length = 503

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519362-1|ABP68471.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519361-1|ABP68470.1|  497|Anopheles gambiae LRIM1 protein.
          Length = 497

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519360-1|ABP68469.1|  499|Anopheles gambiae LRIM1 protein.
          Length = 499

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519359-1|ABP68468.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519358-1|ABP68467.1|  497|Anopheles gambiae LRIM1 protein.
          Length = 497

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519357-1|ABP68466.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519356-1|ABP68465.1|  500|Anopheles gambiae LRIM1 protein.
          Length = 500

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519355-1|ABP68464.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519354-1|ABP68463.1|  506|Anopheles gambiae LRIM1 protein.
          Length = 506

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519353-1|ABP68462.1|  470|Anopheles gambiae LRIM1 protein.
          Length = 470

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519352-1|ABP68461.1|  448|Anopheles gambiae LRIM1 protein.
          Length = 448

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519351-1|ABP68460.1|  486|Anopheles gambiae LRIM1 protein.
          Length = 486

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519350-1|ABP68459.1|  421|Anopheles gambiae LRIM1 protein.
          Length = 421

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519349-1|ABP68458.1|  486|Anopheles gambiae LRIM1 protein.
          Length = 486

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519348-1|ABP68457.1|  503|Anopheles gambiae LRIM1 protein.
          Length = 503

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>EF519347-1|ABP68456.1|  470|Anopheles gambiae LRIM1 protein.
          Length = 470

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 309 TLGHYGAYCCE 319


>AY344814-1|AAR03842.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 234 TLGHYGAYCCE 244


>AY344813-1|AAR03841.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 234 TLGHYGAYCCE 244


>AY344812-1|AAR03840.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 234 TLGHYGAYCCE 244


>AY344811-1|AAR03839.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 234 TLGHYGAYCCE 244


>AY344810-1|AAR03838.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 234 TLGHYGAYCCE 244


>AY344809-1|AAR03837.1|  286|Anopheles gambiae LRR Toll protein.
          Length = 286

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 131 TL*HFGTFCCD 163
           TL H+G +CC+
Sbjct: 234 TLGHYGAYCCE 244


>AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate
           anion exchanger protein.
          Length = 1102

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = +2

Query: 308 HSQRRQHQRH 337
           HSQRR+H+ H
Sbjct: 49  HSQRRRHKHH 58


>AJ439353-7|CAD27929.1|  555|Anopheles gambiae putative glycerol
           kinase protein.
          Length = 555

 Score = 22.2 bits (45), Expect = 7.6
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = +3

Query: 291 VRMTQLIHNDGSTSDTVIEV 350
           +R+TQ++  DG T    +EV
Sbjct: 38  IRITQIVPRDGWTEHNPVEV 57


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 409,913
Number of Sequences: 2352
Number of extensions: 8289
Number of successful extensions: 55
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 33349914
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -