SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0021_D24
         (389 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   2.2  
DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    22   2.9  
X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alp...    21   3.8  
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    21   5.0  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               20   8.7  
AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.        20   8.7  
AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.        20   8.7  
AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.        20   8.7  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             20   8.7  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 22.2 bits (45), Expect = 2.2
 Identities = 11/34 (32%), Positives = 16/34 (47%)
 Frame = +2

Query: 194 RLKYALTGNEVLKIVKQRLIKVDGKVRTDPTYPA 295
           R K+ LTG   L   K RL+  +      P +P+
Sbjct: 182 RTKHRLTGETRLSATKGRLVITEPVGSVRPKFPS 215


>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 21.8 bits (44), Expect = 2.9
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +1

Query: 4   RHEGFFLVQSFV 39
           RH G+FL+Q +V
Sbjct: 242 RHTGYFLIQVYV 253


>X52884-1|CAA37066.1|  461|Apis mellifera elongation factor 1 alpha
           protein.
          Length = 461

 Score = 21.4 bits (43), Expect = 3.8
 Identities = 10/40 (25%), Positives = 21/40 (52%)
 Frame = +2

Query: 236 VKQRLIKVDGKVRTDPTYPAGFMDVVSIEKTNELFRVIYD 355
           VKQ ++ V+    TDP Y     + +  E ++ + ++ Y+
Sbjct: 145 VKQLIVGVNKMDMTDPPYSEARFEEIKKEVSSYIKKIGYN 184


>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 21.0 bits (42), Expect = 5.0
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 53  GPKKHLKRLNAP 88
           GPK+HL+ L  P
Sbjct: 336 GPKEHLRSLGIP 347


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 10/34 (29%), Positives = 18/34 (52%)
 Frame = +2

Query: 212 TGNEVLKIVKQRLIKVDGKVRTDPTYPAGFMDVV 313
           T +++    + R+ ++   VRT    P GF D+V
Sbjct: 733 TMSQMPPTAQPRMERLAEAVRTASQIPQGFKDLV 766


>AY336529-1|AAQ02340.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 338 ITHLFSQWIQRP 303
           + HLF  W  RP
Sbjct: 667 LLHLFGSWSNRP 678


>AY336528-1|AAQ02339.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 338 ITHLFSQWIQRP 303
           + HLF  W  RP
Sbjct: 667 LLHLFGSWSNRP 678


>AY217097-1|AAO39761.1|  712|Apis mellifera transferrin protein.
          Length = 712

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -1

Query: 338 ITHLFSQWIQRP 303
           + HLF  W  RP
Sbjct: 667 LLHLFGSWSNRP 678


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 20.2 bits (40), Expect = 8.7
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 132  RGAYTPPSLSN 100
            RG YTPP  +N
Sbjct: 994  RGRYTPPQPAN 1004


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 111,464
Number of Sequences: 438
Number of extensions: 2226
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used:  9514659
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -