SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0020_J23
         (236 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced prot...    24   0.29 
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    24   0.29 
EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.          20   3.6  
EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      20   3.6  
AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamat...    20   4.7  
AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamat...    20   4.7  

>AB264335-1|BAF44090.1|   87|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 87

 Score = 23.8 bits (49), Expect = 0.29
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 158 EQTLEWLRCTINDKCSLL-IFREKYFYMYLLKRI 60
           +Q +++  CT N +CS+L I R +  Y  L K I
Sbjct: 47  QQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCI 80


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 23.8 bits (49), Expect = 0.29
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 158 EQTLEWLRCTINDKCSLL-IFREKYFYMYLLKRI 60
           +Q +++  CT N +CS+L I R +  Y  L K I
Sbjct: 96  QQKIQYRPCTKNQQCSILRINRNRCQYCRLKKCI 129


>EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.
          Length = 686

 Score = 20.2 bits (40), Expect = 3.6
 Identities = 4/12 (33%), Positives = 11/12 (91%)
 Frame = -1

Query: 107 LIFREKYFYMYL 72
           +++ +KYFY+++
Sbjct: 532 MVYLQKYFYLFM 543


>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 20.2 bits (40), Expect = 3.6
 Identities = 4/12 (33%), Positives = 11/12 (91%)
 Frame = -1

Query: 107 LIFREKYFYMYL 72
           +++ +KYFY+++
Sbjct: 532 MVYLQKYFYLFM 543


>AY463910-1|AAR24352.1|  843|Apis mellifera metabotropic glutamate
           receptor 1 protein.
          Length = 843

 Score = 19.8 bits (39), Expect = 4.7
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 184 GYRYQVVAK 210
           GY+YQVV K
Sbjct: 415 GYQYQVVGK 423


>AB161181-1|BAD08343.1|  933|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 933

 Score = 19.8 bits (39), Expect = 4.7
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 184 GYRYQVVAK 210
           GY+YQVV K
Sbjct: 505 GYQYQVVGK 513


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 54,267
Number of Sequences: 438
Number of extensions: 869
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 47
effective length of database: 125,757
effective search space used:  3898467
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.4 bits)

- SilkBase 1999-2023 -