Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0020_G02
         (166 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.    25   0.33 
AY193728-1|AAO62001.1|  519|Anopheles gambiae cytochrome P450 CY...    23   1.8  
AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.          21   4.1  
AY330183-1|AAQ16289.1|  190|Anopheles gambiae odorant-binding pr...    21   4.1  
AY330182-1|AAQ16288.1|  181|Anopheles gambiae odorant-binding pr...    21   4.1  
AJ618927-1|CAF02006.1|  235|Anopheles gambiae odorant-binding pr...    21   4.1  
AJ618925-1|CAF02004.1|  204|Anopheles gambiae odorant-binding pr...    21   4.1  

>AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.
          Length = 1201

 Score = 25.0 bits (52), Expect = 0.33
 Identities = 13/46 (28%), Positives = 18/46 (39%)
 Frame = -1

Query: 139 SYYDVTVPAATCKKYSFVLVTETMPTRPFRHRTER*RPDTDFMKRI 2
           +YY   +    C K  +  V  T   R F H  E  R  T  +K +
Sbjct: 532 AYYGPVIENFNCDKSIYTAVEVTAGNRLFHHIVESDRVGTQILKEM 577


>AY193728-1|AAO62001.1|  519|Anopheles gambiae cytochrome P450
           CYPm3r5 protein.
          Length = 519

 Score = 22.6 bits (46), Expect = 1.8
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = -1

Query: 145 NVSYYDVTVPAATCKKYSFVLVTETMPTRPFR 50
           N+ Y D  +   T +KY  V + E + T+P+R
Sbjct: 363 NMLYLDQCI-YETLRKYPPVAILERIVTKPYR 393


>AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.
          Length = 1132

 Score = 21.4 bits (43), Expect = 4.1
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -2

Query: 75  RLCQLDRSVTER 40
           RLC+L+R  TER
Sbjct: 325 RLCELNREPTER 336


>AY330183-1|AAQ16289.1|  190|Anopheles gambiae odorant-binding
           protein AgamOBP57 protein.
          Length = 190

 Score = 21.4 bits (43), Expect = 4.1
 Identities = 5/12 (41%), Positives = 10/12 (83%)
 Frame = +1

Query: 91  NYIFCMWRRVRL 126
           +++FC+WR+  L
Sbjct: 142 DFVFCLWRQFTL 153


>AY330182-1|AAQ16288.1|  181|Anopheles gambiae odorant-binding
           protein AgamOBP56 protein.
          Length = 181

 Score = 21.4 bits (43), Expect = 4.1
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +1

Query: 91  NYIFCMWRRVRL 126
           N+ +CMWR++ L
Sbjct: 134 NFGYCMWRQMAL 145


>AJ618927-1|CAF02006.1|  235|Anopheles gambiae odorant-binding
           protein OBPjj7a protein.
          Length = 235

 Score = 21.4 bits (43), Expect = 4.1
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +1

Query: 91  NYIFCMWRRVRL 126
           N+ +CMWR++ L
Sbjct: 188 NFGYCMWRQMAL 199


>AJ618925-1|CAF02004.1|  204|Anopheles gambiae odorant-binding
           protein OBP14426 protein.
          Length = 204

 Score = 21.4 bits (43), Expect = 4.1
 Identities = 5/12 (41%), Positives = 10/12 (83%)
 Frame = +1

Query: 91  NYIFCMWRRVRL 126
           +++FC+WR+  L
Sbjct: 156 DFVFCLWRQFTL 167


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 148,878
Number of Sequences: 2352
Number of extensions: 1910
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 563,979
effective HSP length: 33
effective length of database: 486,363
effective search space used: 10213623
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)