Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0020_G02
         (166 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.      20   3.2  
EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    19   4.2  
AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    19   7.4  
EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.          18   9.7  
EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      18   9.7  
DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.              18   9.7  

>AB207270-1|BAE72137.1|  429|Apis mellifera broad-complex protein.
          Length = 429

 Score = 19.8 bits (39), Expect = 3.2
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -2

Query: 42  RNGSVPTPIS 13
           R GS+PTP++
Sbjct: 152 RGGSLPTPVT 161


>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 19.4 bits (38), Expect = 4.2
 Identities = 8/32 (25%), Positives = 15/32 (46%)
 Frame = +2

Query: 14  EIGVGTLPFRSVTERSSWHSLSN*YKTIFFAC 109
           E G GT+P +S     +W  +    + +  +C
Sbjct: 404 ESGEGTIPVKSSEGIQTWDGVLMGQRLLTMSC 435


>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 18.6 bits (36), Expect = 7.4
 Identities = 6/18 (33%), Positives = 10/18 (55%)
 Frame = -3

Query: 155 CPLERIIL*RNRTRRHMQ 102
           C   RI+L   R + H++
Sbjct: 227 CAARRIVLEERRAQSHLE 244


>EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.
          Length = 686

 Score = 18.2 bits (35), Expect = 9.7
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -1

Query: 31  RPDTDFMK 8
           RPDT +MK
Sbjct: 151 RPDTKYMK 158


>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 18.2 bits (35), Expect = 9.7
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -1

Query: 31  RPDTDFMK 8
           RPDT +MK
Sbjct: 151 RPDTKYMK 158


>DQ435327-1|ABD92642.1|  145|Apis mellifera OBP10 protein.
          Length = 145

 Score = 18.2 bits (35), Expect = 9.7
 Identities = 4/11 (36%), Positives = 8/11 (72%)
 Frame = +1

Query: 94  YIFCMWRRVRL 126
           Y++C+W +  L
Sbjct: 72  YMYCLWEQFGL 82


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 39,865
Number of Sequences: 438
Number of extensions: 736
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 34
effective length of database: 131,451
effective search space used:  2629020
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 35 (18.9 bits)