SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0020_C09
         (179 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578800-1|AAT07305.1|  379|Anopheles gambiae decapentaplegic pr...    23   1.7  
Y17704-1|CAA76824.2|  401|Anopheles gambiae hypothetical protein...    20   9.1  
EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.          20   9.1  
EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.          20   9.1  

>AY578800-1|AAT07305.1|  379|Anopheles gambiae decapentaplegic
           protein.
          Length = 379

 Score = 22.6 bits (46), Expect = 1.7
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = -2

Query: 133 ATSPVIVQIRWYDVIITGXXXXXXXXSFYFIGTNDLRSNKS 11
           A +PV+ Q+  YD++  G        +F  + T  L  N+S
Sbjct: 124 ARTPVLYQVMVYDIVRPG-VKGKRAPTFLLVDTKTLAINES 163


>Y17704-1|CAA76824.2|  401|Anopheles gambiae hypothetical protein
           protein.
          Length = 401

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 8/24 (33%), Positives = 14/24 (58%)
 Frame = +1

Query: 4   RGSIYYCVNHWYL*NKNLRETIIK 75
           R +  + +NHW+  +  L ET+ K
Sbjct: 78  RDNFLFRLNHWHDDHPFLLETVAK 101


>EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519477-1|ABP73563.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519476-1|ABP73561.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519475-1|ABP73559.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519474-1|ABP73557.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519473-1|ABP73555.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519472-1|ABP73553.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519471-1|ABP73551.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519470-1|ABP73549.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519469-1|ABP73547.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519468-1|ABP73545.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519467-1|ABP73543.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519466-1|ABP73541.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519465-1|ABP73539.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519464-1|ABP73537.1|  160|Anopheles gambiae CTLMA2 protein.
          Length = 160

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 83  FYWIGANDL 91


>EF519463-1|ABP73535.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 85  FYWIGANDL 93


>EF519462-1|ABP73533.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52 FYFIGTNDL 26
          FY+IG NDL
Sbjct: 70 FYWIGANDL 78


>EF519461-1|ABP73531.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52 FYFIGTNDL 26
          FY+IG NDL
Sbjct: 70 FYWIGANDL 78


>EF519460-1|ABP73529.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 80  FYWIGANDL 88


>EF519459-1|ABP73527.1|  157|Anopheles gambiae CTLMA2 protein.
          Length = 157

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 80  FYWIGANDL 88


>EF519458-1|ABP73525.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519457-1|ABP73523.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519456-1|ABP73521.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519455-1|ABP73519.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 86  FYWIGANDL 94


>EF519454-1|ABP73517.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 87  FYWIGANDL 95


>EF519453-1|ABP73515.1|  163|Anopheles gambiae CTLMA2 protein.
          Length = 163

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 86  FYWIGANDL 94


>EF519452-1|ABP73513.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519451-1|ABP73511.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 74  FYWIGANDL 82


>EF519448-1|ABP73505.1|  151|Anopheles gambiae CTLMA2 protein.
          Length = 151

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 74  FYWIGANDL 82


>EF519447-1|ABP73503.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519446-1|ABP73501.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519445-1|ABP73499.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519444-1|ABP73497.1|  154|Anopheles gambiae CTLMA2 protein.
          Length = 154

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 77  FYWIGANDL 85


>EF519443-1|ABP73495.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 88  FYWIGANDL 96


>EF519442-1|ABP73493.1|  162|Anopheles gambiae CTLMA2 protein.
          Length = 162

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 85  FYWIGANDL 93


>EF519441-1|ABP73491.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 97  FYWIGANDL 105


>EF519440-1|ABP73489.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 97  FYWIGANDL 105


>EF519439-1|ABP73487.1|  174|Anopheles gambiae CTLMA2 protein.
          Length = 174

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 97  FYWIGANDL 105


>EF519438-1|ABP73485.1|  164|Anopheles gambiae CTLMA2 protein.
          Length = 164

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52  FYFIGTNDL 26
           FY+IG NDL
Sbjct: 87  FYWIGANDL 95


>EF519437-1|ABP73483.1|  147|Anopheles gambiae CTLMA2 protein.
          Length = 147

 Score = 20.2 bits (40), Expect = 9.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -2

Query: 52 FYFIGTNDL 26
          FY+IG NDL
Sbjct: 70 FYWIGANDL 78


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,717
Number of Sequences: 2352
Number of extensions: 2952
Number of successful extensions: 42
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 42
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42
length of database: 563,979
effective HSP length: 38
effective length of database: 474,603
effective search space used:  9966663
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -