SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0020_A24
         (144 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0290 - 7130304-7130416,7130999-7131804,7132730-7132937,713...    27   2.1  

>03_02_0290 -
           7130304-7130416,7130999-7131804,7132730-7132937,
           7132983-7133153,7134091-7134187,7134814-7134873
          Length = 484

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 126 DNMYLTFICIIVQMQKSI*SYKIVATYITQIKLVPLLV 13
           DNM+ TFI   + M+K I S++I A     I ++ +L+
Sbjct: 233 DNMFSTFIEQGMVMEKHIGSFEIPAASFQSIDVIAVLI 270


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,120,199
Number of Sequences: 37544
Number of extensions: 35136
Number of successful extensions: 57
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 57
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 57
length of database: 14,793,348
effective HSP length: 28
effective length of database: 13,742,116
effective search space used: 261100204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -