BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0014_P05
(437 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297-4134|AAN14112.1| 412|Drosophila melanogaster CG31061-P... 28 6.4
>AE014297-4134|AAN14112.1| 412|Drosophila melanogaster CG31061-PA
protein.
Length = 412
Score = 27.9 bits (59), Expect = 6.4
Identities = 15/63 (23%), Positives = 31/63 (49%)
Frame = +2
Query: 41 RSVSRHVFG*LSERELDYLFVSIKKNSTTKRHLFGIVRDYSVFLNIR*YLHLLYTMIIYL 220
+ +S + G S + L V++K+N ++G+V + S++ + L LY + L
Sbjct: 213 QQISVELEGNQSRDSVQELCVALKRNQLLAGRIWGLVNEVSLYFTLSLTLLFLYNELTIL 272
Query: 221 ALV 229
+V
Sbjct: 273 QIV 275
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,443,227
Number of Sequences: 53049
Number of extensions: 299108
Number of successful extensions: 620
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 610
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 620
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1396986582
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -