BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0014_N09
(587 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 22 3.9
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.8
>AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin
releasing hormone-binding protein protein.
Length = 332
Score = 22.2 bits (45), Expect = 3.9
Identities = 13/48 (27%), Positives = 19/48 (39%)
Frame = +1
Query: 388 TSIEESVVVIYDTKKSARGFLTLKAYRLTPQAIAMYKEGDYTPDALRN 531
TS + V+ Y KS +GF + P+ + P LRN
Sbjct: 163 TSSQNIAVIEYRIPKSGKGFSLFARFLKNPRPCNVLATSLTEPYTLRN 210
>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
Length = 1946
Score = 21.4 bits (43), Expect = 6.8
Identities = 7/13 (53%), Positives = 9/13 (69%)
Frame = -2
Query: 412 PPHSPQLRFDSDT 374
PPHSPQ+ + T
Sbjct: 1366 PPHSPQITLTATT 1378
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,421
Number of Sequences: 438
Number of extensions: 3598
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17115420
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -