Samia BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0014_K08
         (428 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-718|AAM71081.1|  105|Drosophila melanogaster CG30352-PA...    27   8.1  

>AE013599-718|AAM71081.1|  105|Drosophila melanogaster CG30352-PA
           protein.
          Length = 105

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 18/50 (36%), Positives = 22/50 (44%)
 Frame = +1

Query: 178 YIINPLSTFPAFTPAFHYFPIVFLLFHFYGYTRHINISFV*FTFAHGFTF 327
           YI+ P   F +  P        F  F FY +TR I+I  V    A  FTF
Sbjct: 58  YILTPFCEFSSLYPLRWLNAFFFCRFVFYMFTRKISIIIV--AVAVRFTF 105


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,707,215
Number of Sequences: 53049
Number of extensions: 231582
Number of successful extensions: 432
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 415
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 432
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1334434944
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)