BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0014_K06
(635 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 23 8.1
>DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein.
Length = 447
Score = 23.0 bits (47), Expect = 8.1
Identities = 11/44 (25%), Positives = 24/44 (54%)
Frame = +3
Query: 489 DSVESANKEIALWFTEKEVVGWTPAAENWVYE*IPLQTNISKPF 620
++ ++A K + F+E VG++ A + + IP+ T + + F
Sbjct: 118 EAYDTARKSLRGRFSESNAVGFSSADKLFFGRQIPVSTCVQQKF 161
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 675,089
Number of Sequences: 2352
Number of extensions: 14551
Number of successful extensions: 15
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 62305095
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -