SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0014_A07
         (363 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    23   1.1  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              21   4.5  
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    21   4.5  
DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channe...    20   7.8  
DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid p...    20   7.8  
AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatas...    20   7.8  
AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase prec...    20   7.8  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 23.0 bits (47), Expect = 1.1
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -3

Query: 226 GNNPLNTNASQEW 188
           G NP N N S +W
Sbjct: 678 GGNPFNCNCSMDW 690


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 21.0 bits (42), Expect = 4.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -3

Query: 193 EWCILLYLPRAC 158
           +W IL+Y P AC
Sbjct: 511 QWGILVYEPSAC 522


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 21.0 bits (42), Expect = 4.5
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -1

Query: 63  NSSARGSIV*TPPPGELQLFP 1
           +SS RGS + +P P E    P
Sbjct: 649 SSSRRGSKIGSPTPAESTFIP 669


>DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channel
           protein.
          Length = 463

 Score = 20.2 bits (40), Expect = 7.8
 Identities = 10/37 (27%), Positives = 17/37 (45%)
 Frame = -1

Query: 180 FFIYHELVRKFSSFSQFARLEFHIELFSARASFSMTL 70
           FF++      F++  QFA + +  +  S    FS  L
Sbjct: 278 FFVFLSFAFIFATIIQFAVVHYFTKYGSGECYFSSDL 314


>DQ058012-1|AAY57281.1|  373|Apis mellifera venom allergen acid
           phosphatase protein.
          Length = 373

 Score = 20.2 bits (40), Expect = 7.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 183 YFFIYHELVRKFS 145
           Y++IYH LV + S
Sbjct: 174 YYYIYHTLVAEQS 186


>AY939855-1|AAX33235.1|  388|Apis mellifera venom acid phosphatase
           precursor protein.
          Length = 388

 Score = 20.2 bits (40), Expect = 7.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 183 YFFIYHELVRKFS 145
           Y++IYH LV + S
Sbjct: 189 YYYIYHTLVAEQS 201


>AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase
           precursor protein.
          Length = 156

 Score = 20.2 bits (40), Expect = 7.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 183 YFFIYHELVRKFS 145
           Y++IYH LV + S
Sbjct: 77  YYYIYHTLVAEQS 89


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,365
Number of Sequences: 438
Number of extensions: 1370
Number of successful extensions: 10
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8556345
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -