Samia BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0013_H22
         (464 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-2522|AAF48698.1| 1247|Drosophila melanogaster CG5004-PA...    29   4.1  

>AE014298-2522|AAF48698.1| 1247|Drosophila melanogaster CG5004-PA
           protein.
          Length = 1247

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 13/51 (25%), Positives = 29/51 (56%), Gaps = 2/51 (3%)
 Frame = -2

Query: 424 TVDDANRHHSTVIPDHRCKRSVNARTVVVSTGLNHGYIVTIGQSQH--FNN 278
           T+  ++ +  T++P+   +  ++   ++  T L+ G ++TIG S +  FNN
Sbjct: 64  TIYRSDANEVTLVPEKDSRLLIDGAPILEETKLSQGAMITIGNSNYLRFNN 114


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,877,451
Number of Sequences: 53049
Number of extensions: 361905
Number of successful extensions: 687
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 680
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 687
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1559812275
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)