BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0013_G06
(475 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 25 1.8
>AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR
protein.
Length = 640
Score = 24.6 bits (51), Expect = 1.8
Identities = 12/66 (18%), Positives = 33/66 (50%)
Frame = -3
Query: 410 YYRFCSNHFTLMHVVLLHIFNKIRIIVIIQLCSHLHSIVKFFMACSCVGNGLSSVYQIQS 231
Y++ S +F + + + + ++ I+Q + ++ FF+ VG+ + +++ +
Sbjct: 134 YFQLTS-YFLYITIFVTAVIGNSIVLFIVQSNPRMRTVTNFFITNLAVGDLMMTLFCVPF 192
Query: 230 CRITLF 213
I+LF
Sbjct: 193 TFISLF 198
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 456,416
Number of Sequences: 2352
Number of extensions: 7753
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 41670678
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -