SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0013_D13
         (611 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    25   0.77 
AY739658-1|AAU85297.1|  664|Apis mellifera hyperpolarization-act...    23   2.4  
AY280848-1|AAQ16312.1|  632|Apis mellifera hyperpolarization-act...    23   2.4  
AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase pro...    21   7.2  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   9.5  

>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 24.6 bits (51), Expect = 0.77
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 5/73 (6%)
 Frame = +3

Query: 315 VWETENVDISPNEVSVKFV---RLFRQLKDIKDLINEEYLGARISSACHDVQ-YPA-GAK 479
           ++E EN + S   V +KF    R  + L D+K L N+     + +  C     Y + G +
Sbjct: 105 LFECENKEKS--NVCLKFEEQKRRKKSLDDVKILRNDRIDSYKSNLKCDKCSTYQSNGEE 162

Query: 480 ICKENTANLEQYM 518
           +C EN    +QY+
Sbjct: 163 VCLENCTGYQQYL 175


>AY739658-1|AAU85297.1|  664|Apis mellifera
           hyperpolarization-activated ion channelvariant L
           protein.
          Length = 664

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 351 HWEICLHFLFPTL 313
           HW  CL FL P L
Sbjct: 291 HWSGCLQFLVPML 303


>AY280848-1|AAQ16312.1|  632|Apis mellifera
           hyperpolarization-activated ion channel protein.
          Length = 632

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -3

Query: 351 HWEICLHFLFPTL 313
           HW  CL FL P L
Sbjct: 259 HWSGCLQFLVPML 271


>AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase
           protein.
          Length = 588

 Score = 21.4 bits (43), Expect = 7.2
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +1

Query: 523 MYSNLTQLRKR 555
           +Y+NLT LRKR
Sbjct: 464 LYTNLTALRKR 474


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 9/26 (34%), Positives = 13/26 (50%)
 Frame = +3

Query: 435 ISSACHDVQYPAGAKICKENTANLEQ 512
           +++  H   YPA +  C     NLEQ
Sbjct: 63  LTAQAHHRLYPAFSSSCDPVPGNLEQ 88


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,855
Number of Sequences: 438
Number of extensions: 4284
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18093444
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -