Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0013_D09
         (358 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    25   0.35 
L01589-1|AAA27736.1|   81|Apis mellifera zinc finger protein pro...    21   4.4  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    21   5.8  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    21   5.8  

>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 24.6 bits (51), Expect = 0.35
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = -3

Query: 191 NHSCPHEYSYTHTYANYCHFNSEMYTFAQYH 99
           N+S  + Y+Y + Y NY +  +  Y   QY+
Sbjct: 85  NNSLSNNYNYNNNYNNYNNNYNTNYKKLQYY 115


>L01589-1|AAA27736.1|   81|Apis mellifera zinc finger protein
           protein.
          Length = 81

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 103 YCAKVYISL 129
           YC KVY+SL
Sbjct: 21  YCEKVYVSL 29


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 175 MNIHTRTHT 149
           + +HTRTHT
Sbjct: 219 LKVHTRTHT 227


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
            protein.
          Length = 1770

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -2

Query: 102  PFRHRHYI 79
            PF HRH+I
Sbjct: 985  PFEHRHFI 992


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,574
Number of Sequences: 438
Number of extensions: 1810
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8308335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)