SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0013_B18
         (436 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ485319-1|ABF21078.1|  175|Apis mellifera icarapin variant 2 pr...    23   1.5  
DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1 pr...    23   1.5  
AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-ri...    23   1.5  
AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.    23   1.5  
DQ855482-1|ABH88169.1|  116|Apis mellifera chemosensory protein ...    23   2.0  
AJ973399-1|CAJ01446.1|  116|Apis mellifera hypothetical protein ...    23   2.0  
AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.           22   3.4  
AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.           22   3.4  
DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex det...    21   4.5  
DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    21   4.5  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    21   4.5  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    21   4.5  
AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex det...    21   4.5  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex det...    21   6.0  
DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex det...    21   6.0  
DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex det...    21   6.0  
DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex det...    21   6.0  
DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex det...    21   6.0  
DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex det...    21   6.0  
DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex det...    21   6.0  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    21   6.0  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    21   6.0  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    21   6.0  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    21   6.0  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    21   6.0  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    21   6.0  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    21   6.0  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    21   6.0  
DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    21   6.0  
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    21   6.0  
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    21   6.0  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    21   6.0  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    21   6.0  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    21   6.0  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    21   6.0  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    21   6.0  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    21   6.0  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    21   6.0  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    21   6.0  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    21   6.0  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    21   6.0  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    21   6.0  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    21   6.0  
L01589-1|AAA27736.1|   81|Apis mellifera zinc finger protein pro...    21   7.9  
DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex det...    21   7.9  
DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex det...    21   7.9  
DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex det...    21   7.9  
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    21   7.9  
AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex det...    21   7.9  
AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex det...    21   7.9  
AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex det...    21   7.9  
AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex det...    21   7.9  
AF213012-1|AAG43568.1|  492|Apis mellifera acetylcholinesterase ...    21   7.9  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   7.9  
AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase ...    21   7.9  

>DQ485319-1|ABF21078.1|  175|Apis mellifera icarapin variant 2
           precursor protein.
          Length = 175

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +2

Query: 311 NVQKYKDGSDESTSDSDVELLDNKVESEPEAPRALSLSDDD 433
           N   Y DGSD+ ++   V ++D + ++E       S +D D
Sbjct: 94  NETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSD 134


>DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1
           precursor protein.
          Length = 223

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +2

Query: 311 NVQKYKDGSDESTSDSDVELLDNKVESEPEAPRALSLSDDD 433
           N   Y DGSD+ ++   V ++D + ++E       S +D D
Sbjct: 142 NETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSD 182


>AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-rich
           protein precursor protein.
          Length = 223

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +2

Query: 311 NVQKYKDGSDESTSDSDVELLDNKVESEPEAPRALSLSDDD 433
           N   Y DGSD+ ++   V ++D + ++E       S +D D
Sbjct: 142 NETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSD 182


>AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.
          Length = 223

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +2

Query: 311 NVQKYKDGSDESTSDSDVELLDNKVESEPEAPRALSLSDDD 433
           N   Y DGSD+ ++   V ++D + ++E       S +D D
Sbjct: 142 NETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSD 182


>DQ855482-1|ABH88169.1|  116|Apis mellifera chemosensory protein 1
           protein.
          Length = 116

 Score = 22.6 bits (46), Expect = 2.0
 Identities = 9/17 (52%), Positives = 15/17 (88%)
 Frame = +1

Query: 283 EAWGSQSCRQCTEIQRR 333
           EA+ +Q C++CTEIQ++
Sbjct: 69  EAFQTQ-CKKCTEIQKQ 84


>AJ973399-1|CAJ01446.1|  116|Apis mellifera hypothetical protein
           protein.
          Length = 116

 Score = 22.6 bits (46), Expect = 2.0
 Identities = 9/17 (52%), Positives = 15/17 (88%)
 Frame = +1

Query: 283 EAWGSQSCRQCTEIQRR 333
           EA+ +Q C++CTEIQ++
Sbjct: 69  EAFQTQ-CKKCTEIQKQ 84


>AY703618-1|AAU12614.1|  136|Apis mellifera wingless protein.
          Length = 136

 Score = 21.8 bits (44), Expect = 3.4
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = -3

Query: 392 PTPPYCRGVPRQNPTWTHQNRLC 324
           P+PP+C   P+     TH  R C
Sbjct: 82  PSPPFCEKNPKLGILGTH-GRQC 103


>AY222546-1|AAP69221.1|  135|Apis mellifera wingless protein.
          Length = 135

 Score = 21.8 bits (44), Expect = 3.4
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = -3

Query: 392 PTPPYCRGVPRQNPTWTHQNRLC 324
           P+PP+C   P+     TH  R C
Sbjct: 83  PSPPFCEKNPKLGILGTH-GRQC 104


>DQ325103-1|ABD14117.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 121 PVPVPVYCGNFP 132


>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 125 PVPVPVYCGNFP 136


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 125 PVPVPVYCGNFP 136


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 347 PVPVPVYCGNFP 358


>AY350618-1|AAQ57660.1|  425|Apis mellifera complementary sex
           determiner protein.
          Length = 425

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 9/19 (47%), Positives = 9/19 (47%), Gaps = 1/19 (5%)
 Frame = -3

Query: 398 PVPTPPYCRGV-PRQNPTW 345
           PVP P YC    PR    W
Sbjct: 364 PVPVPIYCGNFPPRSMEPW 382


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>DQ325121-1|ABD14135.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 120 PVPVPIYCGNFP 131


>DQ325120-1|ABD14134.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 120 PVPVPIYCGNFP 131


>DQ325119-1|ABD14133.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 120 PVPVPIYCGNFP 131


>DQ325118-1|ABD14132.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 120 PVPVPIYCGNFP 131


>DQ325117-1|ABD14131.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 120 PVPVPIYCGNFP 131


>DQ325116-1|ABD14130.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 120 PVPVPIYCGNFP 131


>DQ325115-1|ABD14129.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 124 PVPVPIYCGNFP 135


>DQ325114-1|ABD14128.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 120 PVPVPIYCGNFP 131


>DQ325113-1|ABD14127.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 124 PVPVPIYCGNFP 135


>DQ325112-1|ABD14126.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 124 PVPVPIYCGNFP 135


>DQ325111-1|ABD14125.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 124 PVPVPIYCGNFP 135


>DQ325110-1|ABD14124.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 124 PVPVPIYCGNFP 135


>DQ325105-1|ABD14119.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 119 PVPVPIYCGNFP 130


>DQ325104-1|ABD14118.1|  180|Apis mellifera complementary sex
           determiner protein.
          Length = 180

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 119 PVPVPIYCGNFP 130


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 122 PVPVPIYCGNFP 133


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 122 PVPVPIYCGNFP 133


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 122 PVPVPIYCGNFP 133


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 122 PVPVPIYCGNFP 133


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 122 PVPVPIYCGNFP 133


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 122 PVPVPIYCGNFP 133


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 122 PVPVPIYCGNFP 133


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 122 PVPVPIYCGNFP 133


>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 117 PVPVPIYCGNFP 128


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 125 PVPVPIYCGNFP 136


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 130 PVPVPIYCGNFP 141


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPVYCGNFP 131


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 339 PVPVPIYCGNFP 350


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 336 PVPVPIYCGNFP 347


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 345 PVPVPIYCGNFP 356


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 347 PVPVPIYCGNFP 358


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 358 PVPVPIYCGNFP 369


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 365 PVPVPIYCGNFP 376


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 353 PIPVPVYCGNFP 364


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 353 PIPVPVYCGNFP 364


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 357 PVPVPIYCGNFP 368


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 367 PVPVPIYCGNFP 378


>L01589-1|AAA27736.1|   81|Apis mellifera zinc finger protein
           protein.
          Length = 81

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 7/19 (36%), Positives = 13/19 (68%)
 Frame = +1

Query: 268 SGSEGEAWGSQSCRQCTEI 324
           + +EG+A  S SC+ C ++
Sbjct: 7   AAAEGQAKKSFSCKYCEKV 25


>DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 118 PIPVPIYCGNFP 129


>DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 118 PIPVPIYCGNFP 129


>DQ325122-1|ABD14136.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 118 PIPVPIYCGNFP 129


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           P+P P YC   P
Sbjct: 120 PIPVPIYCGNFP 131


>AY569703-1|AAS86656.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 335 PVPIPIYCGNFP 346


>AY569701-1|AAS86654.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 346 PVPIPIYCGNFP 357


>AY569700-1|AAS86653.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 346 PVPIPIYCGNFP 357


>AY569699-1|AAS86652.1|  396|Apis mellifera complementary sex
           determiner protein.
          Length = 396

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 398 PVPTPPYCRGVP 363
           PVP P YC   P
Sbjct: 335 PVPIPIYCGNFP 346


>AF213012-1|AAG43568.1|  492|Apis mellifera acetylcholinesterase
           protein.
          Length = 492

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 433 IIIAEGESSRRLRFRLHLIVEEFHVRIRRGLIRT 332
           +I   GES+      LHLI       +RRG++++
Sbjct: 246 LITIFGESAGGSSVSLHLISPVTRGLVRRGILQS 279


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -3

Query: 371 GVPRQNPTWTH 339
           GVP ++PT TH
Sbjct: 594 GVPSKSPTLTH 604


>AB181702-1|BAE06051.1|  628|Apis mellifera acetylcholinesterase
           protein.
          Length = 628

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -1

Query: 433 IIIAEGESSRRLRFRLHLIVEEFHVRIRRGLIRT 332
           +I   GES+      LHLI       +RRG++++
Sbjct: 246 LITIFGESAGGSSVSLHLISPVTRGLVRRGILQS 279


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 77,057
Number of Sequences: 438
Number of extensions: 1168
Number of successful extensions: 69
Number of sequences better than 10.0: 69
Number of HSP's better than 10.0 without gapping: 69
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 69
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 11368164
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -