SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0012_O03
         (293 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein...    24   0.45 
DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channe...    20   7.3  

>AY661557-1|AAT74557.1|  411|Apis mellifera yellow-f-like protein
           protein.
          Length = 411

 Score = 23.8 bits (49), Expect = 0.45
 Identities = 11/38 (28%), Positives = 19/38 (50%)
 Frame = -1

Query: 206 YSRIYGHNSSVHMLFSITCDYIDDSTCKQYNQSY*YTF 93
           Y  +Y H  S    FS++ + + D T ++ N  Y + F
Sbjct: 252 YKILYFHAMSSIAEFSVSTEVLQDHTLEKSNDYYAFHF 289


>DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channel
           protein.
          Length = 463

 Score = 19.8 bits (39), Expect = 7.3
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -3

Query: 114 SKLLIYFHINNY 79
           S LL+YFH+  +
Sbjct: 201 SMLLVYFHLQRH 212


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,103
Number of Sequences: 438
Number of extensions: 1462
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used:  5994288
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)

- SilkBase 1999-2023 -